Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   FQV73_RS09385 Genome accession   NZ_CP042271
Coordinates   1969325..1969465 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain LPL061     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 1964325..1974465
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FQV73_RS09360 - 1964623..1965006 (-) 384 WP_003152054.1 hotdog fold thioesterase -
  FQV73_RS09365 - 1965028..1965671 (-) 644 Protein_1845 response regulator transcription factor -
  FQV73_RS09370 comP 1965752..1968055 (-) 2304 WP_003152050.1 histidine kinase Regulator
  FQV73_RS09375 comX 1968075..1968254 (-) 180 WP_306383677.1 competence pheromone ComX -
  FQV73_RS09380 comQ 1968208..1969194 (-) 987 WP_269321599.1 class 1 isoprenoid biosynthesis enzyme Regulator
  FQV73_RS09385 degQ 1969325..1969465 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  FQV73_RS09390 - 1969931..1970272 (+) 342 WP_014305721.1 hypothetical protein -
  FQV73_RS09395 - 1970279..1971499 (-) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  FQV73_RS09400 - 1971629..1973095 (-) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  FQV73_RS09405 - 1973113..1973664 (-) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  FQV73_RS09410 - 1973761..1974159 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=376546 FQV73_RS09385 WP_003152043.1 1969325..1969465(-) (degQ) [Bacillus velezensis strain LPL061]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=376546 FQV73_RS09385 WP_003152043.1 1969325..1969465(-) (degQ) [Bacillus velezensis strain LPL061]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891


Multiple sequence alignment