Detailed information    

insolico Bioinformatically predicted

Overview

Name   abrB   Type   Regulator
Locus tag   FQB22_RS04505 Genome accession   NZ_CP042252
Coordinates   848097..848381 (-) Length   94 a.a.
NCBI ID   WP_003185421.1    Uniprot ID   A0A1Y0XQV9
Organism   Bacillus licheniformis strain KNU11     
Function   repression of comK; repression of rok (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 802788..849767 848097..848381 within 0


Gene organization within MGE regions


Location: 802788..849767
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FQB22_RS04220 - 803444..804154 (-) 711 WP_003185310.1 DUF421 domain-containing protein -
  FQB22_RS04225 - 804362..805213 (+) 852 WP_011201632.1 ferritin family protein -
  FQB22_RS04230 - 805369..805962 (+) 594 WP_003185315.1 cupin domain-containing protein -
  FQB22_RS04235 - 806083..807036 (-) 954 WP_003185317.1 glycoside hydrolase family 25 protein -
  FQB22_RS04240 - 807084..807347 (-) 264 WP_011197884.1 phage holin -
  FQB22_RS04245 - 807363..807632 (-) 270 WP_009329192.1 hemolysin XhlA family protein -
  FQB22_RS04250 - 807695..807877 (-) 183 WP_011198303.1 XkdX family protein -
  FQB22_RS04255 - 807874..808188 (-) 315 WP_016886558.1 hypothetical protein -
  FQB22_RS04260 - 808200..809570 (-) 1371 WP_016886557.1 phage baseplate upper protein -
  FQB22_RS04265 - 809591..811546 (-) 1956 WP_016886556.1 right-handed parallel beta-helix repeat-containing protein -
  FQB22_RS04270 - 811582..813294 (-) 1713 WP_016886555.1 phage tail protein -
  FQB22_RS04275 - 813307..814143 (-) 837 WP_016886554.1 phage tail family protein -
  FQB22_RS04280 - 814143..818612 (-) 4470 WP_016886553.1 phage tail tape measure protein -
  FQB22_RS04285 gpG 818821..819183 (-) 363 WP_003185339.1 phage tail assembly chaperone G -
  FQB22_RS04290 - 819236..819853 (-) 618 WP_016886552.1 major tail protein -
  FQB22_RS04295 - 819868..820251 (-) 384 WP_003185344.1 hypothetical protein -
  FQB22_RS04300 - 820248..820646 (-) 399 WP_016886551.1 HK97-gp10 family putative phage morphogenesis protein -
  FQB22_RS04305 - 820646..820954 (-) 309 WP_016886550.1 phage head closure protein -
  FQB22_RS04310 - 820944..821246 (-) 303 WP_016886549.1 head-tail connector protein -
  FQB22_RS04315 - 821257..821694 (-) 438 WP_029326520.1 collagen-like protein -
  FQB22_RS04320 - 821719..823002 (-) 1284 WP_025805204.1 phage major capsid protein -
  FQB22_RS04325 - 823072..823803 (-) 732 WP_016886547.1 head maturation protease, ClpP-related -
  FQB22_RS04330 - 823748..825058 (-) 1311 WP_016886546.1 phage portal protein -
  FQB22_RS04335 - 825059..825253 (-) 195 WP_016886545.1 DUF1056 family protein -
  FQB22_RS04340 - 825263..826972 (-) 1710 WP_016886544.1 terminase large subunit -
  FQB22_RS04345 - 826969..827484 (-) 516 WP_011198313.1 phage terminase small subunit P27 family -
  FQB22_RS22020 - 827550..827786 (+) 237 WP_222433374.1 hypothetical protein -
  FQB22_RS04350 - 827715..828089 (-) 375 WP_011198314.1 HNH endonuclease -
  FQB22_RS04355 - 828116..828424 (-) 309 WP_016886543.1 hypothetical protein -
  FQB22_RS04360 cotD 828641..828865 (-) 225 WP_006637235.1 spore coat protein CotD -
  FQB22_RS04365 - 829604..829984 (-) 381 WP_009329244.1 ArpU family phage packaging/lysis transcriptional regulator -
  FQB22_RS04370 - 830111..830383 (-) 273 WP_011198316.1 DUF5052 family protein -
  FQB22_RS04375 - 830453..830881 (-) 429 WP_011201737.1 putative metallopeptidase -
  FQB22_RS22110 - 830844..830966 (-) 123 WP_257227968.1 hypothetical protein -
  FQB22_RS04380 - 830969..831139 (-) 171 WP_009329251.1 Fur-regulated basic protein FbpA -
  FQB22_RS04385 - 831136..831675 (-) 540 WP_009329253.1 ERCC4 domain-containing protein -
  FQB22_RS04390 - 831672..832109 (-) 438 WP_011198317.1 hypothetical protein -
  FQB22_RS04395 - 832087..832350 (-) 264 WP_016886542.1 hypothetical protein -
  FQB22_RS04400 - 832626..835058 (-) 2433 WP_016886541.1 phage/plasmid primase, P4 family -
  FQB22_RS04405 - 835119..835556 (-) 438 WP_003185383.1 DUF669 domain-containing protein -
  FQB22_RS04410 - 835556..836488 (-) 933 WP_011198320.1 AAA family ATPase -
  FQB22_RS04415 - 836492..837052 (-) 561 WP_016886540.1 host-nuclease inhibitor Gam family protein -
  FQB22_RS04420 - 837144..837386 (-) 243 WP_011198322.1 hypothetical protein -
  FQB22_RS04425 - 837474..837740 (-) 267 WP_009330095.1 YqaH family protein -
  FQB22_RS04430 - 837803..838354 (+) 552 WP_016886538.1 hypothetical protein -
  FQB22_RS21825 - 838326..838481 (-) 156 WP_155266364.1 hypothetical protein -
  FQB22_RS04435 - 838607..839161 (-) 555 WP_003185401.1 hypothetical protein -
  FQB22_RS04440 - 839219..839407 (-) 189 WP_016886536.1 hypothetical protein -
  FQB22_RS04445 - 839539..839727 (-) 189 WP_003185403.1 helix-turn-helix transcriptional regulator -
  FQB22_RS04450 - 839724..840518 (-) 795 WP_016886535.1 ORF6N domain-containing protein -
  FQB22_RS04455 - 840580..840897 (+) 318 WP_016886534.1 hypothetical protein -
  FQB22_RS04460 - 840860..841129 (-) 270 WP_016886533.1 hypothetical protein -
  FQB22_RS04465 - 841144..841383 (-) 240 WP_016886532.1 helix-turn-helix domain-containing protein -
  FQB22_RS04470 - 841540..842190 (+) 651 WP_016886531.1 LexA family protein -
  FQB22_RS04475 - 842261..843355 (+) 1095 WP_003185410.1 tyrosine-type recombinase/integrase -
  FQB22_RS04485 smpB 843907..844380 (-) 474 WP_009329604.1 SsrA-binding protein SmpB -
  FQB22_RS04490 rnr 844492..846795 (-) 2304 WP_003185414.1 ribonuclease R -
  FQB22_RS04495 - 846809..847555 (-) 747 WP_011198329.1 alpha/beta hydrolase -
  FQB22_RS04500 secG 847696..847926 (-) 231 WP_003185418.1 preprotein translocase subunit SecG -
  FQB22_RS04505 abrB 848097..848381 (-) 285 WP_003185421.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Regulator
  FQB22_RS04510 - 848410..848643 (-) 234 WP_085959538.1 helix-turn-helix domain-containing protein -
  FQB22_RS04515 - 848796..849197 (+) 402 WP_009329609.1 transcriptional regulator -
  FQB22_RS04520 - 849369..849767 (+) 399 WP_009329610.1 helix-turn-helix domain-containing protein -

Sequence

Protein


Download         Length: 94 a.a.        Molecular weight: 10486.36 Da        Isoelectric Point: 7.9620

>NTDB_id=376260 FQB22_RS04505 WP_003185421.1 848097..848381(-) (abrB) [Bacillus licheniformis strain KNU11]
MKNTGIVRRIDELGRVVLPVEMRRVLNINEKDPLEIYTDGENIILTKYAANMACLMTGDITTKNKTYAGGKIVLSPRGAE
MLLEDMMAALSEKK

Nucleotide


Download         Length: 285 bp        

>NTDB_id=376260 FQB22_RS04505 WP_003185421.1 848097..848381(-) (abrB) [Bacillus licheniformis strain KNU11]
GTGAAAAATACCGGGATTGTCCGGAGAATCGATGAGCTCGGCAGAGTCGTTCTCCCGGTCGAAATGCGCAGGGTGCTGAA
TATCAATGAAAAGGACCCGCTCGAAATATATACCGACGGCGAAAACATCATTTTGACAAAATACGCCGCAAACATGGCAT
GTTTGATGACCGGCGACATCACCACGAAAAATAAAACGTATGCGGGCGGCAAAATCGTACTCAGCCCGCGCGGAGCGGAA
ATGCTCCTGGAAGATATGATGGCGGCACTGTCAGAAAAGAAATAA

Domains

Predicted by InterproScan.

AbrB C-terminal domain (AbrB_C)

(53-85)

Antidote-toxin recognition MazE, bacterial antitoxin (MazE_antitoxin)

(9-50)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A1Y0XQV9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  abrB Bacillus subtilis subsp. subtilis str. 168

56.044

96.809

0.543

Multiple sequence alignment