Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   G4G26_RS12290 Genome accession   NZ_CP049924
Coordinates   2420641..2421024 (-) Length   127 a.a.
NCBI ID   WP_038429292.1    Uniprot ID   -
Organism   Bacillus subtilis strain So1b     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2415641..2426024
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  G4G26_RS12250 (G4G26_12285) sinI 2416575..2416748 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  G4G26_RS12255 (G4G26_12290) sinR 2416782..2417117 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  G4G26_RS12260 (G4G26_12295) tasA 2417210..2417995 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  G4G26_RS12265 (G4G26_12300) sipW 2418059..2418631 (-) 573 WP_003230181.1 signal peptidase I -
  G4G26_RS12270 (G4G26_12305) tapA 2418615..2419376 (-) 762 WP_015714251.1 amyloid fiber anchoring/assembly protein TapA -
  G4G26_RS12275 (G4G26_12310) yqzG 2419648..2419974 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  G4G26_RS12280 (G4G26_12315) spoIIT 2420016..2420195 (-) 180 WP_014480252.1 YqzE family protein -
  G4G26_RS12285 (G4G26_12320) comGG 2420266..2420640 (-) 375 WP_015714252.1 ComG operon protein ComGG Machinery gene
  G4G26_RS12290 (G4G26_12325) comGF 2420641..2421024 (-) 384 WP_038429292.1 ComG operon protein ComGF Machinery gene
  G4G26_RS12295 (G4G26_12330) comGE 2421050..2421397 (-) 348 WP_015714254.1 ComG operon protein 5 Machinery gene
  G4G26_RS12300 (G4G26_12335) comGD 2421381..2421812 (-) 432 WP_015714255.1 comG operon protein ComGD Machinery gene
  G4G26_RS12305 (G4G26_12340) comGC 2421802..2422098 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  G4G26_RS12310 (G4G26_12345) comGB 2422112..2423149 (-) 1038 WP_015714257.1 comG operon protein ComGB Machinery gene
  G4G26_RS12315 (G4G26_12350) comGA 2423136..2424206 (-) 1071 WP_015714258.1 competence protein ComGA Machinery gene
  G4G26_RS12320 (G4G26_12355) - 2424418..2424615 (-) 198 WP_014480259.1 CBS domain-containing protein -
  G4G26_RS12325 (G4G26_12360) corA 2424617..2425570 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14547.68 Da        Isoelectric Point: 6.4849

>NTDB_id=375657 G4G26_RS12290 WP_038429292.1 2420641..2421024(-) (comGF) [Bacillus subtilis strain So1b]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSRQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADFENGVVLLKIESEDQKVYQTAFPVYSYLGGR

Nucleotide


Download         Length: 384 bp        

>NTDB_id=375657 G4G26_RS12290 WP_038429292.1 2420641..2421024(-) (comGF) [Bacillus subtilis strain So1b]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCAGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATTTTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGAGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

97.619

99.213

0.969


Multiple sequence alignment