Detailed information    

insolico Bioinformatically predicted

Overview


Name   vraS   Type   Regulator
Locus tag   FP478_RS11020 Genome accession   NZ_CP042043
Coordinates   2206153..2207196 (-) Length   347 a.a.
NCBI ID   WP_001017131.1    Uniprot ID   A0A0D1IMN4
Organism   Staphylococcus aureus strain B2-15A     
Function   repress expression of competence genes (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 2169470..2230544 2206153..2207196 within 0


Gene organization within MGE regions


Location: 2169470..2230544
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FP478_RS10815 (FP478_10815) perR 2170058..2170504 (-) 447 WP_000110007.1 peroxide-responsive transcriptional repressor PerR -
  FP478_RS10820 (FP478_10820) - 2170601..2171551 (-) 951 WP_000869446.1 phosphoglycerate dehydrogenase -
  FP478_RS10825 (FP478_10825) bcp 2171557..2172012 (-) 456 WP_000939521.1 thioredoxin-dependent thiol peroxidase -
  FP478_RS10830 (FP478_10830) - 2172093..2173382 (+) 1290 WP_001011595.1 glutamate-1-semialdehyde 2,1-aminomutase -
  FP478_RS10835 (FP478_10835) - 2173675..2174769 (+) 1095 WP_001236371.1 FUSC family protein -
  FP478_RS10840 (FP478_10840) - 2174859..2174950 (-) 92 Protein_2062 hypothetical protein -
  FP478_RS10845 (FP478_10845) - 2174959..2176695 (-) 1737 WP_000597238.1 SAV1866 family putative multidrug efflux ABC transporter -
  FP478_RS10850 (FP478_10850) - 2176986..2177528 (-) 543 WP_000251253.1 DUF402 domain-containing protein -
  FP478_RS10855 (FP478_10855) mutY 2177831..2178868 (-) 1038 WP_000284765.1 A/G-specific adenine glycosylase -
  FP478_RS10860 (FP478_10860) - 2179020..2179997 (+) 978 WP_000379098.1 metal-dependent hydrolase -
  FP478_RS10870 (FP478_10870) - 2180258..2181094 (-) 837 WP_000886462.1 membrane protein -
  FP478_RS10875 (FP478_10875) - 2181103..2182620 (-) 1518 WP_000535834.1 ABC transporter ATP-binding protein -
  FP478_RS10880 (FP478_10880) - 2182635..2182949 (-) 315 WP_000435806.1 YfhH family protein -
  FP478_RS10885 (FP478_10885) recX 2182927..2183745 (-) 819 WP_001124422.1 recombination regulator RecX -
  FP478_RS10890 (FP478_10890) sgtB 2184005..2184814 (-) 810 WP_000830380.1 monofunctional peptidoglycan glycosyltransferase SgtB -
  FP478_RS10895 (FP478_10895) - 2185154..2185669 (-) 516 WP_000163283.1 type 1 glutamine amidotransferase domain-containing protein -
  FP478_RS10900 (FP478_10900) - 2185800..2185961 (-) 162 WP_001005407.1 SE1561 family protein -
  FP478_RS10905 (FP478_10905) yfkAB 2186185..2187336 (+) 1152 WP_001089621.1 radical SAM/CxCxxxxC motif protein YfkAB -
  FP478_RS10910 (FP478_10910) - 2187459..2187743 (+) 285 WP_000134547.1 hypothetical protein -
  FP478_RS10915 (FP478_10915) - 2187894..2188214 (+) 321 WP_000805733.1 DUF961 family protein -
  FP478_RS10920 (FP478_10920) - 2188228..2188530 (+) 303 WP_000386891.1 hypothetical protein -
  FP478_RS10925 (FP478_10925) - 2188705..2189796 (+) 1092 WP_000172943.1 replication initiation factor domain-containing protein -
  FP478_RS10930 (FP478_10930) - 2189857..2190912 (+) 1056 WP_000692002.1 conjugal transfer protein -
  FP478_RS10935 (FP478_10935) - 2190917..2191177 (+) 261 WP_000015639.1 TcpD family membrane protein -
  FP478_RS10940 (FP478_10940) - 2191189..2191572 (+) 384 WP_000358144.1 TcpE family conjugal transfer membrane protein -
  FP478_RS10945 (FP478_10945) - 2191607..2194102 (+) 2496 WP_001049264.1 ATP-binding protein -
  FP478_RS10950 (FP478_10950) - 2194156..2195514 (+) 1359 WP_001251209.1 FtsK/SpoIIIE domain-containing protein -
  FP478_RS10955 (FP478_10955) - 2195519..2197366 (+) 1848 WP_000681156.1 CD3337/EF1877 family mobilome membrane protein -
  FP478_RS10960 (FP478_10960) - 2197356..2198403 (+) 1048 Protein_2085 CHAP domain-containing protein -
  FP478_RS10965 (FP478_10965) - 2198410..2199000 (+) 591 WP_000810443.1 hypothetical protein -
  FP478_RS10970 (FP478_10970) - 2199056..2199412 (+) 357 WP_001255379.1 cystatin-like fold lipoprotein -
  FP478_RS10975 (FP478_10975) - 2199521..2200024 (+) 504 WP_000746373.1 transposase -
  FP478_RS10980 (FP478_10980) - 2200053..2200541 (+) 489 WP_142377520.1 IS30 family transposase -
  FP478_RS10985 (FP478_10985) - 2200954..2201484 (-) 531 WP_000184383.1 acyl-CoA thioesterase -
  FP478_RS10990 (FP478_10990) - 2201574..2202830 (-) 1257 WP_001795108.1 aminopeptidase -
  FP478_RS10995 (FP478_10995) - 2202833..2203033 (-) 201 WP_000180460.1 DUF1128 family protein -
  FP478_RS11000 (FP478_11000) - 2203180..2203644 (+) 465 WP_000228666.1 low molecular weight protein-tyrosine-phosphatase -
  FP478_RS11005 (FP478_11005) - 2203651..2203926 (+) 276 WP_000428172.1 YtxH domain-containing protein -
  FP478_RS11010 (FP478_11010) - 2204204..2205421 (+) 1218 WP_000037075.1 YihY/virulence factor BrkB family protein -
  FP478_RS11015 (FP478_11015) vraR 2205534..2206163 (-) 630 WP_000153535.1 two-component system response regulator VraR Regulator
  FP478_RS11020 (FP478_11020) vraS 2206153..2207196 (-) 1044 WP_001017131.1 sensor histidine kinase Regulator
  FP478_RS11025 (FP478_11025) liaF 2207193..2207894 (-) 702 WP_000149064.1 cell wall-active antibiotics response protein LiaF -
  FP478_RS11030 (FP478_11030) - 2207909..2208295 (-) 387 WP_001110179.1 hypothetical protein -
  FP478_RS11035 (FP478_11035) map 2208512..2209270 (-) 759 WP_000636142.1 type I methionyl aminopeptidase -
  FP478_RS11040 (FP478_11040) - 2209801..2210787 (+) 987 WP_000999717.1 FUSC family protein -
  FP478_RS11045 (FP478_11045) - 2211218..2211631 (-) 414 WP_001557448.1 hypothetical protein -
  FP478_RS11050 (FP478_11050) - 2211660..2211770 (-) 111 WP_001790257.1 hypothetical protein -
  FP478_RS11055 (FP478_11055) - 2211856..2212587 (-) 732 WP_000544969.1 type 1 glutamine amidotransferase -
  FP478_RS11060 (FP478_11060) murT 2212589..2213902 (-) 1314 WP_001250343.1 lipid II isoglutaminyl synthase subunit MurT -
  FP478_RS11065 (FP478_11065) ftnA 2214194..2214694 (+) 501 WP_000949467.1 H-type ferritin FtnA -
  FP478_RS11070 (FP478_11070) - 2214776..2214868 (-) 93 WP_001790679.1 hypothetical protein -
  FP478_RS11075 (FP478_11075) - 2215083..2215637 (+) 555 WP_000613738.1 3'-5' exonuclease -
  FP478_RS11080 (FP478_11080) dinB 2215705..2216775 (-) 1071 WP_000140172.1 DNA polymerase IV -
  FP478_RS11085 (FP478_11085) - 2217022..2217552 (-) 531 WP_000548781.1 DUF3267 domain-containing protein -
  FP478_RS11090 (FP478_11090) rlmD 2217722..2219083 (-) 1362 WP_001147865.1 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD -
  FP478_RS11095 (FP478_11095) - 2219164..2220111 (-) 948 WP_001231451.1 diacylglycerol kinase -
  FP478_RS11100 (FP478_11100) - 2220637..2220783 (-) 147 WP_001789566.1 hypothetical protein -
  FP478_RS11105 (FP478_11105) gatB 2220823..2222250 (-) 1428 WP_000545370.1 Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatB -
  FP478_RS11110 (FP478_11110) gatA 2222263..2223720 (-) 1458 WP_000027917.1 Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA -
  FP478_RS11115 (FP478_11115) gatC 2223722..2224024 (-) 303 WP_000170162.1 Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC -
  FP478_RS11120 (FP478_11120) putP 2224391..2225929 (+) 1539 WP_000957020.1 sodium/proline symporter PutP -
  FP478_RS11125 (FP478_11125) - 2226018..2227217 (-) 1200 WP_000831700.1 CamS family sex pheromone protein -
  FP478_RS11130 (FP478_11130) ligA 2227230..2229233 (-) 2004 WP_000774556.1 NAD-dependent DNA ligase LigA -

Sequence


Protein


Download         Length: 347 a.a.        Molecular weight: 40044.52 Da        Isoelectric Point: 6.0577

>NTDB_id=375631 FP478_RS11020 WP_001017131.1 2206153..2207196(-) (vraS) [Staphylococcus aureus strain B2-15A]
MNHYIRTIGSMLILVYSMLAAFLFIDKVFVNIIYFQGMFYTQIFGIPVFLFLNLIIILLCIIVGSVLAYKINQQNDWIKT
QIERSMEGETVGINDQNIEIYSETLDLYHTLVPLNQELHKLRLKTQNLTNENYNINDVKVKKIIEDERQRLARELHDSVS
QQLFAASMMLSAIKETKLEPPLDQQIPILEKMVQDSQLEMRALLLHLRPLGLKDKSLGEGIKDLVIDLQKKVPMKVVHEI
QDFKVPKGIEDHLFRITQEAISNTLRHSNGTKVTVELFNKDDYLLLRIQDNGKGFNVDEKLEQSYGLKNMRERALEIGAT
FHIVSLPDSGTRIEVKAPLNKEDSYDD

Nucleotide


Download         Length: 1044 bp        

>NTDB_id=375631 FP478_RS11020 WP_001017131.1 2206153..2207196(-) (vraS) [Staphylococcus aureus strain B2-15A]
ATGAACCACTACATTAGAACAATTGGTTCAATGCTCATCTTAGTATATAGCATGCTAGCTGCATTTCTATTCATCGATAA
AGTTTTTGTAAATATCATCTATTTTCAAGGTATGTTTTATACACAAATATTCGGAATACCAGTCTTTTTATTTTTAAATC
TCATCATCATATTATTGTGTATTATTGTTGGTTCGGTACTCGCATACAAAATCAATCAGCAAAATGATTGGATTAAGACG
CAAATTGAGCGTTCAATGGAAGGCGAAACAGTTGGCATTAATGATCAAAATATAGAAATATATAGTGAAACGTTAGATTT
ATACCATACACTCGTACCTTTAAATCAAGAATTGCATAAGTTGCGACTTAAAACTCAAAACTTAACCAATGAAAATTATA
ATATTAATGATGTGAAAGTTAAAAAGATTATTGAAGATGAACGTCAAAGACTAGCTCGAGAACTTCACGATTCTGTTAGT
CAGCAACTTTTTGCGGCAAGTATGATGCTTTCTGCTATCAAAGAAACGAAGTTAGAACCACCATTAGACCAACAAATTCC
GATTTTAGAGAAAATGGTTCAAGATTCGCAGTTAGAAATGCGTGCTTTGCTGTTACATTTAAGACCGCTTGGTTTAAAAG
ACAAATCTTTAGGTGAGGGTATTAAAGATTTAGTTATTGATTTACAAAAAAAAGTGCCAATGAAAGTTGTGCATGAAATA
CAAGATTTTAAAGTGCCTAAAGGTATTGAAGATCATTTGTTCAGAATTACACAGGAAGCAATTTCGAATACATTGCGTCA
TTCAAACGGTACAAAAGTGACAGTAGAATTGTTTAATAAAGACGATTATTTATTGTTGAGAATTCAAGATAATGGTAAAG
GTTTTAATGTTGATGAAAAATTAGAACAAAGTTATGGACTTAAAAATATGCGTGAAAGAGCTTTGGAAATTGGTGCAACG
TTCCATATTGTATCATTGCCAGATTCAGGTACACGTATCGAGGTGAAAGCACCTTTAAATAAGGAGGATTCGTATGACGA
TTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A0D1IMN4

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  vraS Staphylococcus aureus N315

100

100

1


Multiple sequence alignment