Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   G7052_RS03210 Genome accession   NZ_CP049799
Coordinates   640873..641157 (+) Length   94 a.a.
NCBI ID   WP_002987779.1    Uniprot ID   A0A0H2USY2
Organism   Streptococcus pyogenes strain 1040     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 635873..646157
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  G7052_RS03185 (G7052_03185) - 637819..638184 (+) 366 WP_002986560.1 DUF1033 family protein -
  G7052_RS03190 (G7052_03190) comGA 638277..639215 (+) 939 WP_002986557.1 competence type IV pilus ATPase ComGA Machinery gene
  G7052_RS03195 (G7052_03195) comGB 639151..640185 (+) 1035 WP_011054115.1 competence type IV pilus assembly protein ComGB Machinery gene
  G7052_RS03200 (G7052_03200) comGC 640187..640513 (+) 327 WP_032465607.1 competence type IV pilus major pilin ComGC Machinery gene
  G7052_RS03205 (G7052_03205) comGD 640488..640916 (+) 429 WP_002986548.1 competence type IV pilus minor pilin ComGD Machinery gene
  G7052_RS03210 (G7052_03210) comGE 640873..641157 (+) 285 WP_002987779.1 competence type IV pilus minor pilin ComGE Machinery gene
  G7052_RS03215 (G7052_03215) comGF 641150..641584 (+) 435 WP_023612536.1 competence type IV pilus minor pilin ComGF Machinery gene
  G7052_RS03220 (G7052_03220) comGG 641568..641894 (+) 327 WP_136274078.1 competence type IV pilus minor pilin ComGG -
  G7052_RS03225 (G7052_03225) comGH 641992..642945 (+) 954 WP_136274080.1 class I SAM-dependent methyltransferase Machinery gene
  G7052_RS03230 (G7052_03230) - 643004..644200 (+) 1197 WP_023612537.1 acetate kinase -
  G7052_RS03235 (G7052_03235) - 644387..644695 (+) 309 WP_010921804.1 hypothetical protein -
  G7052_RS03240 (G7052_03240) proC 644778..645548 (-) 771 WP_136274084.1 pyrroline-5-carboxylate reductase -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10672.62 Da        Isoelectric Point: 8.9043

>NTDB_id=375263 G7052_RS03210 WP_002987779.1 640873..641157(+) (comGE) [Streptococcus pyogenes strain 1040]
MGIIKKQVKAYIALESMIATGILFSIVILVLSSLQQSQAALTYYRKQQEKLNLALMAVQTRTKEMTLNGCHITILRTDRY
ISIHDDEGEVMKIE

Nucleotide


Download         Length: 285 bp        

>NTDB_id=375263 G7052_RS03210 WP_002987779.1 640873..641157(+) (comGE) [Streptococcus pyogenes strain 1040]
GTGGGAATTATCAAAAAACAAGTCAAAGCTTACATAGCCCTTGAAAGTATGATCGCAACAGGCATCCTCTTTAGTATTGT
CATTCTCGTCTTAAGCAGTTTACAGCAGAGTCAGGCTGCTCTAACGTACTATCGAAAGCAGCAAGAAAAGCTTAATCTAG
CCTTGATGGCAGTACAAACTAGAACTAAAGAGATGACATTGAATGGTTGTCATATTACTATTTTACGTACGGATAGATAC
ATTAGTATTCACGATGACGAAGGAGAAGTGATGAAGATTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A0H2USY2

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Lactococcus lactis subsp. cremoris KW2

38.298

100

0.383


Multiple sequence alignment