Detailed information    

insolico Bioinformatically predicted

Overview


Name   comE/blpR   Type   Regulator
Locus tag   G8B40_RS09495 Genome accession   NZ_CP049692
Coordinates   392468..392686 (+) Length   72 a.a.
NCBI ID   WP_011528334.1    Uniprot ID   -
Organism   Streptococcus pyogenes strain ABC157     
Function   activate transcription of early competence genes; regulation of comX expression (predicted from homology)   
Competence regulation

Genomic Context


Location: 387468..397686
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  G8B40_RS02035 (G8B40_02040) - 388477..389052 (+) 576 WP_009880369.1 uracil-DNA glycosylase family protein -
  G8B40_RS02040 (G8B40_02045) ybeY 389211..389708 (+) 498 WP_002985748.1 rRNA maturation RNase YbeY -
  G8B40_RS02045 (G8B40_02050) - 389689..390096 (+) 408 WP_002985746.1 diacylglycerol kinase family protein -
  G8B40_RS02050 (G8B40_02055) era 390216..391112 (+) 897 WP_003047080.1 GTPase Era -
  G8B40_RS02055 (G8B40_02060) - 391132..391608 (+) 477 WP_014635332.1 NUDIX hydrolase -
  G8B40_RS09490 (G8B40_02065) - 391913..392167 (-) 255 WP_010921971.1 hypothetical protein -
  G8B40_RS09495 comE/blpR 392468..392686 (+) 219 WP_011528334.1 LytTR family transcriptional regulator DNA-binding domain-containing protein Regulator
  G8B40_RS09500 - 392883..394489 (-) 1607 Protein_358 ABC transporter transmembrane domain-containing protein -
  G8B40_RS02080 (G8B40_02090) - 394787..395011 (+) 225 WP_002994580.1 Blp family class II bacteriocin -
  G8B40_RS02085 (G8B40_02095) - 394989..395165 (+) 177 WP_002994581.1 hypothetical protein -
  G8B40_RS09720 (G8B40_02100) - 395489..395770 (+) 282 WP_151412331.1 CPBP family intramembrane glutamic endopeptidase -
  G8B40_RS09505 - 395855..395983 (+) 129 WP_002994583.1 hypothetical protein -
  G8B40_RS02095 (G8B40_02105) - 396381..396608 (+) 228 WP_042769846.1 Blp family class II bacteriocin -
  G8B40_RS02100 (G8B40_02110) - 396657..396974 (+) 318 WP_021299375.1 hypothetical protein -

Sequence


Protein


Download         Length: 72 a.a.        Molecular weight: 8680.16 Da        Isoelectric Point: 10.5045

>NTDB_id=374735 G8B40_RS09495 WP_011528334.1 392468..392686(+) (comE/blpR) [Streptococcus pyogenes strain ABC157]
MVLYSTRERIEFYGELSEIVKQEPRLFQCHRSFVVNPYNISSIQRLERKIYLKKRFILSSIKAKSYCSKRSS

Nucleotide


Download         Length: 219 bp        

>NTDB_id=374735 G8B40_RS09495 WP_011528334.1 392468..392686(+) (comE/blpR) [Streptococcus pyogenes strain ABC157]
TTGGTTCTTTATTCTACTAGAGAAAGGATTGAATTTTATGGGGAGTTATCTGAAATCGTTAAGCAAGAACCAAGATTATT
TCAATGCCATCGATCATTTGTTGTTAATCCCTACAATATATCTTCAATACAACGATTAGAACGTAAGATTTATTTAAAAA
AACGGTTCATCTTGTCTAGTATCAAGGCTAAAAGTTACTGCTCTAAAAGAAGCAGTTGA

Domains


Predicted by InterProScan.

(3-56)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comE/blpR Streptococcus mutans UA159

56.604

73.611

0.417