Detailed information    

insolico Bioinformatically predicted

Overview


Name   comE/blpR   Type   Regulator
Locus tag   G8B43_RS09915 Genome accession   NZ_CP049689
Coordinates   1531239..1531457 (-) Length   72 a.a.
NCBI ID   WP_011528334.1    Uniprot ID   -
Organism   Streptococcus pyogenes strain ABC221     
Function   activate transcription of early competence genes; regulation of comX expression (predicted from homology)   
Competence regulation

Genomic Context


Location: 1526239..1536457
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  G8B43_RS07810 (G8B43_07865) - 1526951..1527268 (-) 318 WP_021299375.1 hypothetical protein -
  G8B43_RS07815 (G8B43_07870) - 1527317..1527544 (-) 228 WP_042769846.1 Blp family class II bacteriocin -
  G8B43_RS09905 - 1527942..1528070 (-) 129 WP_002994583.1 hypothetical protein -
  G8B43_RS10015 (G8B43_07875) - 1528155..1528439 (-) 285 WP_079891230.1 CPBP family intramembrane glutamic endopeptidase -
  G8B43_RS07825 (G8B43_07880) - 1528760..1528936 (-) 177 WP_002994581.1 hypothetical protein -
  G8B43_RS07830 (G8B43_07885) - 1528914..1529138 (-) 225 WP_002994580.1 Blp family class II bacteriocin -
  G8B43_RS09910 - 1529436..1531042 (+) 1607 Protein_1499 ABC transporter transmembrane domain-containing protein -
  G8B43_RS09915 comE/blpR 1531239..1531457 (-) 219 WP_011528334.1 LytTR family transcriptional regulator DNA-binding domain-containing protein Regulator
  G8B43_RS07855 (G8B43_07910) - 1531758..1532012 (+) 255 WP_010921971.1 hypothetical protein -
  G8B43_RS07860 (G8B43_07915) - 1532317..1532793 (-) 477 WP_014635332.1 NUDIX hydrolase -
  G8B43_RS07865 (G8B43_07920) era 1532813..1533709 (-) 897 WP_003047080.1 GTPase Era -
  G8B43_RS07870 (G8B43_07925) - 1533829..1534236 (-) 408 WP_002985746.1 diacylglycerol kinase family protein -
  G8B43_RS07875 (G8B43_07930) ybeY 1534217..1534714 (-) 498 WP_002985748.1 rRNA maturation RNase YbeY -
  G8B43_RS07880 (G8B43_07935) - 1534873..1535448 (-) 576 WP_009880369.1 uracil-DNA glycosylase family protein -

Sequence


Protein


Download         Length: 72 a.a.        Molecular weight: 8680.16 Da        Isoelectric Point: 10.5045

>NTDB_id=374445 G8B43_RS09915 WP_011528334.1 1531239..1531457(-) (comE/blpR) [Streptococcus pyogenes strain ABC221]
MVLYSTRERIEFYGELSEIVKQEPRLFQCHRSFVVNPYNISSIQRLERKIYLKKRFILSSIKAKSYCSKRSS

Nucleotide


Download         Length: 219 bp        

>NTDB_id=374445 G8B43_RS09915 WP_011528334.1 1531239..1531457(-) (comE/blpR) [Streptococcus pyogenes strain ABC221]
TTGGTTCTTTATTCTACTAGAGAAAGGATTGAATTTTATGGGGAGTTATCTGAAATCGTTAAGCAAGAACCAAGATTATT
TCAATGCCATCGATCATTTGTTGTTAATCCCTACAATATATCTTCAATACAACGATTAGAACGTAAGATTTATTTAAAAA
AACGGTTCATCTTGTCTAGTATCAAGGCTAAAAGTTACTGCTCTAAAAGAAGCAGTTGA

Domains


Predicted by InterProScan.

(3-56)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comE/blpR Streptococcus mutans UA159

56.604

73.611

0.417