Detailed information    

insolico Bioinformatically predicted

Overview

Name   phrC   Type   Regulator
Locus tag   FNS63_RS15770 Genome accession   NZ_CP041770
Coordinates   3221875..3221994 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus amyloliquefaciens strain DH8030     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context

Location: 3216875..3226994
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FNS63_RS15755 (FNS63_15750) - 3218487..3219170 (+) 684 WP_024084885.1 response regulator transcription factor -
  FNS63_RS15760 (FNS63_15755) - 3219157..3220590 (+) 1434 WP_161625271.1 HAMP domain-containing sensor histidine kinase -
  FNS63_RS15765 (FNS63_15760) rapC 3220743..3221891 (+) 1149 WP_003156336.1 Rap family tetratricopeptide repeat protein Regulator
  FNS63_RS15770 (FNS63_15765) phrC 3221875..3221994 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  FNS63_RS15775 (FNS63_15770) - 3222144..3222254 (-) 111 WP_369719092.1 YjcZ family sporulation protein -
  FNS63_RS15780 (FNS63_15775) - 3222334..3223698 (-) 1365 WP_003156333.1 aspartate kinase -
  FNS63_RS15785 (FNS63_15780) ceuB 3224113..3225066 (+) 954 WP_003156332.1 ABC transporter permease Machinery gene
  FNS63_RS15790 (FNS63_15785) - 3225056..3226003 (+) 948 WP_003156331.1 iron chelate uptake ABC transporter family permease subunit -
  FNS63_RS15795 (FNS63_15790) - 3225997..3226755 (+) 759 WP_003156330.1 ABC transporter ATP-binding protein -

Sequence

Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=374049 FNS63_RS15770 WP_003156334.1 3221875..3221994(+) (phrC) [Bacillus amyloliquefaciens strain DH8030]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=374049 FNS63_RS15770 WP_003156334.1 3221875..3221994(+) (phrC) [Bacillus amyloliquefaciens strain DH8030]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA

Domains

Predicted by InterproScan.

Rap-phr extracellular signalling (PhrC_PhrF)

(3-39)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718

Multiple sequence alignment