Detailed information
Bioinformatically predicted
Overview
| Name | abrB | Type | Regulator |
| Locus tag | BMB171_RS12775 | Genome accession | NC_014171 |
| Coordinates | 2506503..2506781 (+) | Length | 92 a.a. |
| NCBI ID | WP_000799090.1 | Uniprot ID | A0A9X6FVM5 |
| Organism | Bacillus thuringiensis BMB171 | ||
| Function | repression of comK; repression of rok (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2496148..2537166 | 2506503..2506781 | within | 0 |
Gene organization within MGE regions
Location: 2496148..2537166
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BMB171_RS12710 (BMB171_C2314) | - | 2496148..2496411 (+) | 264 | WP_002082716.1 | DUF3937 domain-containing protein | - |
| BMB171_RS12715 | - | 2496967..2497296 (+) | 330 | WP_001071361.1 | heterocycloanthracin/sonorensin family bacteriocin | - |
| BMB171_RS30230 | - | 2497446..2497582 (+) | 137 | Protein_2439 | site-specific integrase | - |
| BMB171_RS12720 | - | 2497792..2498277 (+) | 486 | WP_002041181.1 | hypothetical protein | - |
| BMB171_RS12725 (BMB171_C2315) | - | 2498589..2499290 (+) | 702 | WP_000736203.1 | DUF3962 domain-containing protein | - |
| BMB171_RS12730 (BMB171_C2316) | - | 2499329..2500438 (-) | 1110 | WP_000675854.1 | tyrosine-type recombinase/integrase | - |
| BMB171_RS12735 (BMB171_C2317) | - | 2500742..2501935 (+) | 1194 | WP_000440006.1 | exosporium leader peptide-containing protein | - |
| BMB171_RS12740 (BMB171_C2318) | - | 2502500..2503651 (+) | 1152 | WP_000265306.1 | AimR family lysis-lysogeny pheromone receptor | - |
| BMB171_RS12745 | - | 2503689..2503835 (+) | 147 | WP_000720927.1 | hypothetical protein | - |
| BMB171_RS31480 (BMB171_C2319) | - | 2503990..2504118 (+) | 129 | WP_000836786.1 | hypothetical protein | - |
| BMB171_RS12750 | - | 2504154..2504507 (-) | 354 | WP_000491272.1 | helix-turn-helix transcriptional regulator | - |
| BMB171_RS12755 (BMB171_C2321) | - | 2504708..2504899 (+) | 192 | WP_000854271.1 | helix-turn-helix transcriptional regulator | - |
| BMB171_RS12760 (BMB171_C2322) | - | 2504956..2505222 (+) | 267 | WP_000522034.1 | helix-turn-helix domain-containing protein | - |
| BMB171_RS30915 (BMB171_C2323) | - | 2505222..2505386 (+) | 165 | WP_000390285.1 | hypothetical protein | - |
| BMB171_RS12770 (BMB171_C2324) | - | 2505444..2506499 (+) | 1056 | WP_001060924.1 | DnaD domain protein | - |
| BMB171_RS12775 | abrB | 2506503..2506781 (+) | 279 | WP_000799090.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Regulator |
| BMB171_RS12780 (BMB171_C2325) | - | 2506774..2507133 (+) | 360 | WP_001125949.1 | hypothetical protein | - |
| BMB171_RS12785 (BMB171_C2326) | - | 2507152..2507319 (+) | 168 | WP_000717826.1 | DUF3954 domain-containing protein | - |
| BMB171_RS12790 (BMB171_C2327) | - | 2507347..2507598 (+) | 252 | WP_000109498.1 | hypothetical protein | - |
| BMB171_RS12795 (BMB171_C2328) | - | 2507618..2508073 (+) | 456 | WP_001102016.1 | nucleoside triphosphate pyrophosphohydrolase family protein | - |
| BMB171_RS12800 (BMB171_C2329) | - | 2508341..2509129 (-) | 789 | WP_000185203.1 | sulfotransferase family 2 domain-containing protein | - |
| BMB171_RS12805 (BMB171_C2330) | - | 2510231..2510986 (+) | 756 | WP_000783004.1 | DNA cytosine methyltransferase | - |
| BMB171_RS30920 | - | 2511023..2511163 (+) | 141 | WP_179191799.1 | hypothetical protein | - |
| BMB171_RS12810 | - | 2511304..2511594 (-) | 291 | WP_001045720.1 | hypothetical protein | - |
| BMB171_RS30925 | - | 2511826..2511996 (+) | 171 | WP_000645540.1 | hypothetical protein | - |
| BMB171_RS12820 (BMB171_C2331) | - | 2512024..2512497 (+) | 474 | WP_000166200.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| BMB171_RS12825 (BMB171_C2332) | - | 2512497..2513039 (+) | 543 | WP_001012177.1 | site-specific integrase | - |
| BMB171_RS12830 | - | 2513375..2513791 (-) | 417 | WP_001061495.1 | DUF1259 domain-containing protein | - |
| BMB171_RS12835 (BMB171_C2333) | - | 2514075..2514785 (+) | 711 | WP_001289208.1 | DUF421 domain-containing protein | - |
| BMB171_RS12840 (BMB171_C2334) | - | 2515298..2515783 (-) | 486 | WP_000100518.1 | hypothetical protein | - |
| BMB171_RS12845 (BMB171_C2335) | - | 2516310..2516522 (+) | 213 | WP_000778974.1 | hypothetical protein | - |
| BMB171_RS12850 | - | 2516657..2516995 (+) | 339 | WP_000333451.1 | hypothetical protein | - |
| BMB171_RS12855 | - | 2517000..2517230 (+) | 231 | WP_000964490.1 | hypothetical protein | - |
| BMB171_RS12860 (BMB171_C2336) | - | 2517223..2517558 (+) | 336 | WP_001008152.1 | HNH endonuclease | - |
| BMB171_RS12865 | - | 2517711..2518046 (+) | 336 | WP_000124846.1 | P27 family phage terminase small subunit | - |
| BMB171_RS12870 (BMB171_C2338) | - | 2518043..2519701 (+) | 1659 | WP_000615662.1 | terminase TerL endonuclease subunit | - |
| BMB171_RS12875 (BMB171_C2339) | - | 2519767..2520873 (+) | 1107 | WP_013141970.1 | phage portal protein | - |
| BMB171_RS12880 (BMB171_C2340) | - | 2520857..2521639 (+) | 783 | WP_000216392.1 | head maturation protease, ClpP-related | - |
| BMB171_RS12885 (BMB171_C2341) | - | 2521643..2522797 (+) | 1155 | WP_000234867.1 | phage major capsid protein | - |
| BMB171_RS12890 | - | 2522803..2523096 (+) | 294 | WP_001098848.1 | hypothetical protein | - |
| BMB171_RS12895 (BMB171_C2342) | - | 2523098..2523451 (+) | 354 | WP_001247286.1 | phage head closure protein | - |
| BMB171_RS12900 (BMB171_C2343) | - | 2523453..2523797 (+) | 345 | WP_000997564.1 | HK97 gp10 family phage protein | - |
| BMB171_RS12905 | - | 2523794..2524123 (+) | 330 | WP_000172097.1 | hypothetical protein | - |
| BMB171_RS12910 (BMB171_C2344) | - | 2524124..2524717 (+) | 594 | WP_001114731.1 | major tail protein | - |
| BMB171_RS12915 (BMB171_C2345) | - | 2524724..2525080 (+) | 357 | WP_000415935.1 | hypothetical protein | - |
| BMB171_RS12920 (BMB171_C2347) | - | 2525311..2526519 (+) | 1209 | Protein_2482 | hypothetical protein | - |
| BMB171_RS12925 (BMB171_C2348) | - | 2526777..2527034 (+) | 258 | WP_000566747.1 | hypothetical protein | - |
| BMB171_RS12930 (BMB171_C2349) | - | 2527252..2529342 (+) | 2091 | WP_000180080.1 | hypothetical protein | - |
| BMB171_RS12935 (BMB171_C2350) | - | 2529384..2530859 (+) | 1476 | WP_000093919.1 | distal tail protein Dit | - |
| BMB171_RS12940 (BMB171_C2351) | - | 2530856..2535766 (+) | 4911 | WP_001260223.1 | phage tail spike protein | - |
| BMB171_RS12945 (BMB171_C2352) | - | 2535806..2536231 (+) | 426 | WP_000373893.1 | phage holin family protein | - |
| BMB171_RS12950 (BMB171_C2353) | - | 2536231..2537166 (+) | 936 | WP_000405785.1 | N-acetylmuramoyl-L-alanine amidase | - |
Sequence
Protein
Download Length: 92 a.a. Molecular weight: 10091.64 Da Isoelectric Point: 6.2246
>NTDB_id=37303 BMB171_RS12775 WP_000799090.1 2506503..2506781(+) (abrB) [Bacillus thuringiensis BMB171]
MKNTGVARKVDELGRVVIPVELRRTLGIVEGTALDFHIDGENIVLRKHEKSCFVTGEVSETNIELLGGRMFLSKEGASEL
LDFIQKSGLAHA
MKNTGVARKVDELGRVVIPVELRRTLGIVEGTALDFHIDGENIVLRKHEKSCFVTGEVSETNIELLGGRMFLSKEGASEL
LDFIQKSGLAHA
Nucleotide
Download Length: 279 bp
>NTDB_id=37303 BMB171_RS12775 WP_000799090.1 2506503..2506781(+) (abrB) [Bacillus thuringiensis BMB171]
ATGAAAAACACAGGCGTTGCAAGAAAAGTGGACGAGCTAGGTCGTGTAGTAATTCCAGTAGAGTTACGCAGAACTTTAGG
GATTGTCGAAGGAACGGCACTAGATTTTCATATCGATGGTGAAAACATTGTTTTAAGAAAACATGAAAAGTCATGCTTTG
TAACGGGTGAAGTGTCTGAAACCAACATAGAGTTGCTAGGTGGCCGAATGTTTTTAAGCAAGGAAGGGGCAAGTGAATTA
CTGGATTTTATTCAGAAGAGTGGGCTGGCACATGCCTAA
ATGAAAAACACAGGCGTTGCAAGAAAAGTGGACGAGCTAGGTCGTGTAGTAATTCCAGTAGAGTTACGCAGAACTTTAGG
GATTGTCGAAGGAACGGCACTAGATTTTCATATCGATGGTGAAAACATTGTTTTAAGAAAACATGAAAAGTCATGCTTTG
TAACGGGTGAAGTGTCTGAAACCAACATAGAGTTGCTAGGTGGCCGAATGTTTTTAAGCAAGGAAGGGGCAAGTGAATTA
CTGGATTTTATTCAGAAGAGTGGGCTGGCACATGCCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| abrB | Bacillus subtilis subsp. subtilis str. 168 |
58.621 |
94.565 |
0.554 |