Detailed information    

insolico Bioinformatically predicted

Overview


Name   cipB   Type   Regulator
Locus tag   ST64987_RS07975 Genome accession   NZ_CP049053
Coordinates   1512872..1513111 (-) Length   79 a.a.
NCBI ID   WP_011681565.1    Uniprot ID   -
Organism   Streptococcus thermophilus strain ST64987     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context


Location: 1507872..1518111
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ST64987_RS07940 (ST64987_1509) - 1509596..1509976 (-) 381 WP_002951783.1 hypothetical protein -
  ST64987_RS07945 - 1510101..1510364 (-) 264 WP_002945924.1 hypothetical protein -
  ST64987_RS07950 (ST64987_1511) - 1510686..1510982 (-) 297 WP_004197070.1 bacteriocin immunity protein -
  ST64987_RS07955 (ST64987_1512) - 1511147..1511353 (-) 207 WP_011681562.1 hypothetical protein -
  ST64987_RS07960 (ST64987_1513) - 1511384..1512076 (-) 693 WP_224103184.1 thioredoxin family protein -
  ST64987_RS07965 (ST64987_1514) - 1512260..1512439 (-) 180 WP_011681564.1 hypothetical protein -
  ST64987_RS07970 (ST64987_1515) - 1512468..1512860 (-) 393 WP_003094909.1 hypothetical protein -
  ST64987_RS07975 (ST64987_1516) cipB 1512872..1513111 (-) 240 WP_011681565.1 Blp family class II bacteriocin Regulator
  ST64987_RS10610 (ST64987_1517) - 1513362..1513763 (-) 402 WP_011226490.1 hypothetical protein -
  ST64987_RS07990 (ST64987_1519) - 1514618..1514779 (-) 162 WP_011681568.1 hypothetical protein -
  ST64987_RS07995 (ST64987_1520) - 1514786..1515016 (-) 231 WP_011226494.1 bacteriocin class II family protein -
  ST64987_RS08000 (ST64987_1522) - 1515372..1515572 (-) 201 WP_011681569.1 hypothetical protein -
  ST64987_RS08005 (ST64987_1523) - 1515591..1515767 (-) 177 WP_011681570.1 Blp family class II bacteriocin -
  ST64987_RS08010 (ST64987_1524) - 1516018..1516755 (+) 738 WP_011681571.1 LytTR family DNA-binding domain-containing protein -
  ST64987_RS10335 comD/blpH 1517286..1518089 (+) 804 WP_223899638.1 ATP-binding protein Regulator

Sequence


Protein


Download         Length: 79 a.a.        Molecular weight: 7727.69 Da        Isoelectric Point: 3.8735

>NTDB_id=371935 ST64987_RS07975 WP_011681565.1 1512872..1513111(-) (cipB) [Streptococcus thermophilus strain ST64987]
MATQTIENFNTLDLETLASVEGGRVNWERWGMCGASVAVGASEGFSAAAGGTAFFIGPYAIGTGAVGAAIGGGVALLGC

Nucleotide


Download         Length: 240 bp        

>NTDB_id=371935 ST64987_RS07975 WP_011681565.1 1512872..1513111(-) (cipB) [Streptococcus thermophilus strain ST64987]
ATGGCAACTCAAACAATTGAAAACTTTAACACCCTCGACCTTGAAACACTTGCTAGTGTTGAAGGAGGACGAGTCAATTG
GGAACGATGGGGAATGTGTGGGGCCTCTGTCGCCGTAGGTGCTTCAGAAGGATTCTCTGCAGCTGCAGGTGGAACGGCTT
TCTTCATTGGACCGTATGCAATTGGAACTGGTGCAGTAGGTGCAGCTATTGGAGGTGGAGTAGCCTTACTTGGCTGTTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

52.459

77.215

0.405