Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | FNL90_RS04020 | Genome accession | NZ_CP041408 |
| Coordinates | 758718..758906 (+) | Length | 62 a.a. |
| NCBI ID | WP_002984426.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain 37-97S | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 712316..761023 | 758718..758906 | within | 0 |
Gene organization within MGE regions
Location: 712316..761023
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FNL90_RS03690 (FNL90_03805) | - | 712316..712936 (-) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
| FNL90_RS03695 (FNL90_03810) | - | 713298..714386 (-) | 1089 | WP_002984265.1 | site-specific integrase | - |
| FNL90_RS03700 (FNL90_03815) | - | 714636..715445 (-) | 810 | WP_002984270.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| FNL90_RS03705 (FNL90_03820) | - | 715458..716195 (-) | 738 | WP_002984272.1 | XRE family transcriptional regulator | - |
| FNL90_RS03710 | - | 716356..716502 (+) | 147 | WP_021340823.1 | hypothetical protein | - |
| FNL90_RS03715 (FNL90_03825) | - | 716499..716981 (-) | 483 | WP_023605145.1 | hypothetical protein | - |
| FNL90_RS03720 (FNL90_03830) | - | 717055..717282 (+) | 228 | WP_002984281.1 | hypothetical protein | - |
| FNL90_RS03725 (FNL90_03835) | - | 717390..717899 (-) | 510 | WP_011017884.1 | hypothetical protein | - |
| FNL90_RS03730 (FNL90_03845) | - | 718158..718367 (-) | 210 | WP_002984292.1 | hypothetical protein | - |
| FNL90_RS09760 | - | 718423..718554 (+) | 132 | WP_002984298.1 | hypothetical protein | - |
| FNL90_RS03735 (FNL90_03850) | - | 718540..718758 (-) | 219 | WP_032467270.1 | hypothetical protein | - |
| FNL90_RS03740 (FNL90_03855) | - | 718902..719087 (+) | 186 | WP_002984304.1 | helix-turn-helix transcriptional regulator | - |
| FNL90_RS03745 (FNL90_03860) | - | 719165..719461 (+) | 297 | WP_002984306.1 | MerR family transcriptional regulator | - |
| FNL90_RS03750 (FNL90_03865) | - | 719458..719595 (+) | 138 | WP_002984309.1 | hypothetical protein | - |
| FNL90_RS03755 (FNL90_03870) | - | 719676..720005 (+) | 330 | WP_002984312.1 | hypothetical protein | - |
| FNL90_RS03760 (FNL90_03875) | - | 720005..720199 (+) | 195 | WP_002984315.1 | hypothetical protein | - |
| FNL90_RS03765 (FNL90_03880) | - | 720196..720480 (+) | 285 | WP_002984318.1 | hypothetical protein | - |
| FNL90_RS03770 (FNL90_03885) | - | 720477..721160 (+) | 684 | WP_002984321.1 | AAA family ATPase | - |
| FNL90_RS03775 (FNL90_03890) | - | 721175..722599 (+) | 1425 | Protein_705 | DEAD/DEAH box helicase | - |
| FNL90_RS03780 (FNL90_03895) | - | 722604..723086 (+) | 483 | WP_002984328.1 | DUF669 domain-containing protein | - |
| FNL90_RS03785 (FNL90_03900) | - | 723104..724657 (+) | 1554 | WP_002984332.1 | hypothetical protein | - |
| FNL90_RS03790 (FNL90_03905) | - | 724924..725793 (+) | 870 | WP_002984334.1 | bifunctional DNA primase/polymerase | - |
| FNL90_RS03795 (FNL90_03910) | - | 725813..726097 (+) | 285 | WP_011017874.1 | VRR-NUC domain-containing protein | - |
| FNL90_RS03800 (FNL90_03915) | - | 726081..726437 (+) | 357 | WP_002984340.1 | hypothetical protein | - |
| FNL90_RS09900 (FNL90_03920) | - | 726434..726670 (+) | 237 | WP_047235251.1 | hypothetical protein | - |
| FNL90_RS03805 (FNL90_03925) | - | 726664..726948 (+) | 285 | WP_020905119.1 | DUF3310 domain-containing protein | - |
| FNL90_RS03810 (FNL90_03930) | - | 726945..727214 (+) | 270 | WP_047235252.1 | hypothetical protein | - |
| FNL90_RS09770 | - | 727228..727347 (+) | 120 | WP_229699513.1 | YopX family protein | - |
| FNL90_RS09775 | - | 727305..727418 (+) | 114 | Protein_715 | YopX family protein | - |
| FNL90_RS03820 (FNL90_03940) | - | 727415..727699 (+) | 285 | WP_011889038.1 | hypothetical protein | - |
| FNL90_RS03825 (FNL90_03945) | - | 727703..728185 (+) | 483 | WP_011017571.1 | class I SAM-dependent methyltransferase | - |
| FNL90_RS03830 (FNL90_03950) | - | 728376..728777 (+) | 402 | WP_002987468.1 | hypothetical protein | - |
| FNL90_RS03835 (FNL90_03955) | - | 728777..729412 (+) | 636 | WP_185168157.1 | N-6 DNA methylase | - |
| FNL90_RS03840 (FNL90_03960) | - | 729681..730118 (+) | 438 | WP_003052405.1 | DUF1492 domain-containing protein | - |
| FNL90_RS03845 (FNL90_03965) | - | 731040..731954 (+) | 915 | WP_011284864.1 | hypothetical protein | - |
| FNL90_RS03850 | - | 732044..732277 (-) | 234 | WP_002995461.1 | hypothetical protein | - |
| FNL90_RS03855 (FNL90_03975) | - | 732573..732950 (-) | 378 | WP_002987543.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| FNL90_RS03860 (FNL90_03980) | - | 733002..733187 (-) | 186 | WP_001132273.1 | type II toxin-antitoxin system HicA family toxin | - |
| FNL90_RS03865 (FNL90_03985) | - | 733286..733717 (+) | 432 | WP_020833531.1 | terminase small subunit | - |
| FNL90_RS03870 (FNL90_03990) | - | 733695..735002 (+) | 1308 | WP_047235253.1 | PBSX family phage terminase large subunit | - |
| FNL90_RS03875 (FNL90_03995) | - | 735014..736516 (+) | 1503 | WP_002984369.1 | phage portal protein | - |
| FNL90_RS03880 (FNL90_04000) | - | 736497..738122 (+) | 1626 | WP_047235254.1 | phage head morphogenesis protein | - |
| FNL90_RS03885 (FNL90_04005) | - | 738113..738292 (+) | 180 | WP_010922213.1 | hypothetical protein | - |
| FNL90_RS03890 (FNL90_04010) | - | 738352..738621 (+) | 270 | WP_002984375.1 | hypothetical protein | - |
| FNL90_RS03895 (FNL90_04015) | - | 738717..738896 (+) | 180 | WP_011017861.1 | hypothetical protein | - |
| FNL90_RS03900 (FNL90_04020) | - | 739011..739259 (+) | 249 | WP_002984380.1 | hypothetical protein | - |
| FNL90_RS03905 (FNL90_04025) | - | 739261..740004 (+) | 744 | WP_002984382.1 | phage repressor protein/antirepressor Ant | - |
| FNL90_RS03910 (FNL90_04030) | - | 740116..740649 (+) | 534 | WP_002984384.1 | DUF4355 domain-containing protein | - |
| FNL90_RS03915 (FNL90_04035) | - | 740659..741039 (+) | 381 | WP_047235255.1 | structural protein | - |
| FNL90_RS03920 (FNL90_04040) | - | 741039..742115 (+) | 1077 | WP_002984388.1 | major capsid protein | - |
| FNL90_RS03925 (FNL90_04045) | - | 742125..742367 (+) | 243 | WP_002984390.1 | HeH/LEM domain-containing protein | - |
| FNL90_RS03930 (FNL90_04050) | - | 742381..742734 (+) | 354 | WP_002984392.1 | phage head-tail connector protein | - |
| FNL90_RS03935 (FNL90_04055) | - | 742731..743039 (+) | 309 | WP_002984393.1 | hypothetical protein | - |
| FNL90_RS03940 (FNL90_04060) | - | 743020..743385 (+) | 366 | WP_002984399.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| FNL90_RS03945 (FNL90_04065) | - | 743382..743771 (+) | 390 | WP_002984401.1 | hypothetical protein | - |
| FNL90_RS03950 (FNL90_04070) | - | 743827..744429 (+) | 603 | WP_002984403.1 | phage major tail protein, TP901-1 family | - |
| FNL90_RS03955 (FNL90_04075) | - | 744482..744841 (+) | 360 | WP_002984405.1 | tail assembly chaperone | - |
| FNL90_RS03960 (FNL90_04080) | - | 744883..745212 (+) | 330 | WP_002984407.1 | hypothetical protein | - |
| FNL90_RS03965 (FNL90_04085) | - | 745227..748493 (+) | 3267 | WP_047235256.1 | tape measure protein | - |
| FNL90_RS03970 (FNL90_04090) | - | 748525..749304 (+) | 780 | WP_002984411.1 | distal tail protein Dit | - |
| FNL90_RS03975 (FNL90_04095) | - | 749301..751352 (+) | 2052 | WP_002984413.1 | phage tail spike protein | - |
| FNL90_RS03980 (FNL90_04100) | - | 751349..752356 (+) | 1008 | WP_047235257.1 | hyaluronoglucosaminidase | - |
| FNL90_RS03985 (FNL90_04105) | - | 752369..754279 (+) | 1911 | WP_002987337.1 | gp58-like family protein | - |
| FNL90_RS03990 (FNL90_04110) | - | 754293..754454 (+) | 162 | WP_002987333.1 | hypothetical protein | - |
| FNL90_RS03995 (FNL90_04115) | - | 754457..755074 (+) | 618 | WP_047235258.1 | DUF1366 domain-containing protein | - |
| FNL90_RS04000 (FNL90_04120) | - | 755084..755359 (+) | 276 | WP_002987582.1 | hypothetical protein | - |
| FNL90_RS04005 (FNL90_04125) | - | 755356..755583 (+) | 228 | WP_003058873.1 | phage holin | - |
| FNL90_RS04010 (FNL90_04130) | - | 755699..756904 (+) | 1206 | WP_002984418.1 | glucosaminidase domain-containing protein | - |
| FNL90_RS04015 (FNL90_04140) | sda3 | 757680..758480 (-) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| FNL90_RS04020 (FNL90_04145) | prx | 758718..758906 (+) | 189 | WP_002984426.1 | hypothetical protein | Regulator |
| FNL90_RS04030 (FNL90_04155) | - | 759497..760111 (+) | 615 | WP_047235259.1 | TVP38/TMEM64 family protein | - |
| FNL90_RS04035 (FNL90_04160) | - | 760238..761023 (-) | 786 | WP_047235260.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7253.32 Da Isoelectric Point: 4.2550
>NTDB_id=371886 FNL90_RS04020 WP_002984426.1 758718..758906(+) (prx) [Streptococcus pyogenes strain 37-97S]
MLTYDEFKQAIDRGYITGDTVMIVRKNGQIFDYVLPHEKVKNGEVVTEEIVEEVMVELDYIK
MLTYDEFKQAIDRGYITGDTVMIVRKNGQIFDYVLPHEKVKNGEVVTEEIVEEVMVELDYIK
Nucleotide
Download Length: 189 bp
>NTDB_id=371886 FNL90_RS04020 WP_002984426.1 758718..758906(+) (prx) [Streptococcus pyogenes strain 37-97S]
ATGCTAACATACGACGAGTTTAAACAAGCGATTGACCGTGGATATATCACAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTTTTGCCACATGAGAAAGTAAAAAATGGAGAAGTTGTGACCGAGGAGATAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
ATGCTAACATACGACGAGTTTAAACAAGCGATTGACCGTGGATATATCACAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTTTTGCCACATGAGAAAGTAAAAAATGGAGAAGTTGTGACCGAGGAGATAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
90.323 |
100 |
0.903 |
| prx | Streptococcus pyogenes MGAS8232 |
87.931 |
93.548 |
0.823 |
| prx | Streptococcus pyogenes MGAS315 |
87.931 |
93.548 |
0.823 |
| prx | Streptococcus pyogenes MGAS315 |
83.051 |
95.161 |
0.79 |
| prx | Streptococcus pyogenes MGAS315 |
79.661 |
95.161 |
0.758 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
66.129 |
0.581 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
67.742 |
0.532 |