Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   CXB71_RS15750 Genome accession   NZ_CP041361
Coordinates   3162140..3162280 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain WRN014     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3157140..3167280
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CXB71_RS15725 (CXB71_15725) - 3157467..3157850 (-) 384 WP_003152054.1 hotdog fold thioesterase -
  CXB71_RS15730 (CXB71_15730) comA 3157872..3158516 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  CXB71_RS15735 (CXB71_15735) comP 3158597..3160903 (-) 2307 WP_044052948.1 sensor histidine kinase Regulator
  CXB71_RS15740 (CXB71_15740) comX 3160922..3161098 (-) 177 WP_044052947.1 competence pheromone ComX -
  CXB71_RS15745 (CXB71_15745) - 3161113..3161988 (-) 876 WP_026092320.1 polyprenyl synthetase family protein -
  CXB71_RS15750 (CXB71_15750) degQ 3162140..3162280 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  CXB71_RS15755 (CXB71_15755) - 3162746..3163087 (+) 342 WP_014305721.1 hypothetical protein -
  CXB71_RS15760 (CXB71_15760) - 3163094..3164314 (-) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  CXB71_RS15765 (CXB71_15765) - 3164444..3165910 (-) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  CXB71_RS15770 (CXB71_15770) - 3165928..3166479 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  CXB71_RS15775 (CXB71_15775) - 3166576..3166974 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=371605 CXB71_RS15750 WP_003152043.1 3162140..3162280(-) (degQ) [Bacillus velezensis strain WRN014]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=371605 CXB71_RS15750 WP_003152043.1 3162140..3162280(-) (degQ) [Bacillus velezensis strain WRN014]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment