Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGC   Type   Machinery gene
Locus tag   BvL003_RS11605 Genome accession   NZ_CP041192
Coordinates   2425194..2425460 (-) Length   88 a.a.
NCBI ID   WP_042635730.1    Uniprot ID   -
Organism   Bacillus velezensis strain BvL03     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2420194..2430460
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BvL003_RS11555 (BvL003_11710) sinR 2420359..2420694 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  BvL003_RS11560 (BvL003_11715) tasA 2420742..2421527 (-) 786 WP_094247735.1 biofilm matrix protein TasA -
  BvL003_RS11565 (BvL003_11720) sipW 2421591..2422175 (-) 585 WP_012117977.1 signal peptidase I SipW -
  BvL003_RS11570 (BvL003_11725) tapA 2422147..2422818 (-) 672 WP_070082109.1 amyloid fiber anchoring/assembly protein TapA -
  BvL003_RS11575 (BvL003_11730) - 2423077..2423406 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  BvL003_RS11580 (BvL003_11735) - 2423446..2423625 (-) 180 WP_003153093.1 YqzE family protein -
  BvL003_RS11585 (BvL003_11740) comGG 2423682..2424059 (-) 378 WP_094247734.1 competence type IV pilus minor pilin ComGG Machinery gene
  BvL003_RS11590 (BvL003_11745) comGF 2424060..2424560 (-) 501 WP_227005764.1 competence type IV pilus minor pilin ComGF -
  BvL003_RS11595 (BvL003_11750) comGE 2424469..2424783 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  BvL003_RS11600 (BvL003_11755) comGD 2424767..2425204 (-) 438 WP_025852922.1 competence type IV pilus minor pilin ComGD Machinery gene
  BvL003_RS11605 (BvL003_11760) comGC 2425194..2425460 (-) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  BvL003_RS11610 (BvL003_11765) comGB 2425507..2426544 (-) 1038 WP_063174751.1 competence type IV pilus assembly protein ComGB Machinery gene
  BvL003_RS11615 (BvL003_11770) comGA 2426531..2427601 (-) 1071 WP_070082113.1 competence type IV pilus ATPase ComGA Machinery gene
  BvL003_RS11620 (BvL003_11775) - 2427793..2428743 (-) 951 WP_071391609.1 magnesium transporter CorA family protein -
  BvL003_RS11625 (BvL003_11780) - 2428889..2430190 (+) 1302 WP_070082114.1 hemolysin family protein -

Sequence


Protein


Download         Length: 88 a.a.        Molecular weight: 9721.32 Da        Isoelectric Point: 6.2027

>NTDB_id=370374 BvL003_RS11605 WP_042635730.1 2425194..2425460(-) (comGC) [Bacillus velezensis strain BvL03]
MLIVLFIVSILLLITIPNVTKHNQSIQHKGCEGLQNMVKAQVTAYEIDHEGKMPDMNDLQSEGYIKKNTACPNGKQILIS
GGEVTVEQ

Nucleotide


Download         Length: 267 bp        

>NTDB_id=370374 BvL003_RS11605 WP_042635730.1 2425194..2425460(-) (comGC) [Bacillus velezensis strain BvL03]
ATGCTGATCGTTTTATTTATCGTTTCCATTCTGCTTTTAATCACCATTCCTAACGTTACAAAACATAATCAAAGCATTCA
GCATAAAGGCTGTGAAGGACTGCAGAATATGGTGAAAGCCCAAGTGACGGCGTACGAAATCGACCATGAAGGTAAAATGC
CGGATATGAACGATTTACAATCAGAGGGGTATATCAAAAAGAATACAGCCTGCCCGAATGGTAAACAGATCTTAATTAGT
GGCGGAGAAGTTACAGTTGAACAATAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGC Bacillus subtilis subsp. subtilis str. 168

74.648

80.682

0.602


Multiple sequence alignment