Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   BLCSL_RS13915 Genome accession   NZ_CP041154
Coordinates   2644398..2644574 (+) Length   58 a.a.
NCBI ID   WP_003183444.1    Uniprot ID   -
Organism   Bacillus licheniformis strain CSL2     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2639398..2649574
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BLCSL_RS13900 (BLCSL_13900) gcvT 2640041..2641135 (-) 1095 WP_003183436.1 glycine cleavage system aminomethyltransferase GcvT -
  BLCSL_RS13905 (BLCSL_13905) - 2641728..2643407 (+) 1680 WP_003183439.1 DEAD/DEAH box helicase -
  BLCSL_RS13910 (BLCSL_13910) - 2643414..2644259 (+) 846 WP_251186353.1 YqhG family protein -
  BLCSL_RS13915 (BLCSL_13915) sinI 2644398..2644574 (+) 177 WP_003183444.1 anti-repressor SinI Regulator
  BLCSL_RS13920 (BLCSL_13920) sinR 2644608..2644943 (+) 336 WP_025804940.1 transcriptional regulator SinR Regulator
  BLCSL_RS13925 (BLCSL_13925) tasA 2645048..2645842 (-) 795 WP_003183447.1 biofilm matrix protein TasA -
  BLCSL_RS13930 (BLCSL_13930) sipW 2645916..2646500 (-) 585 WP_003183449.1 signal peptidase I SipW -
  BLCSL_RS13935 (BLCSL_13935) tapA 2646497..2647225 (-) 729 WP_003183451.1 amyloid fiber anchoring/assembly protein TapA -
  BLCSL_RS13940 (BLCSL_13940) - 2647502..2647822 (+) 321 WP_003183454.1 YqzG/YhdC family protein -
  BLCSL_RS13945 (BLCSL_13945) - 2647846..2648028 (-) 183 WP_003183456.1 YqzE family protein -
  BLCSL_RS13950 (BLCSL_13950) comGG 2648117..2648482 (-) 366 WP_003183459.1 competence type IV pilus minor pilin ComGG -
  BLCSL_RS13955 (BLCSL_13955) comGF 2648495..2648983 (-) 489 WP_011201694.1 competence type IV pilus minor pilin ComGF -
  BLCSL_RS13960 (BLCSL_13960) comGE 2648892..2649239 (-) 348 WP_009327907.1 competence type IV pilus minor pilin ComGE -

Sequence

Protein


Download         Length: 58 a.a.        Molecular weight: 6724.47 Da        Isoelectric Point: 4.7616

>NTDB_id=370002 BLCSL_RS13915 WP_003183444.1 2644398..2644574(+) (sinI) [Bacillus licheniformis strain CSL2]
MNKDKNEKEELDEEWTDLIKHALEQGISPEEIRIFLNLGKKSSNPSTSIERSHSINPF

Nucleotide


Download         Length: 177 bp        

>NTDB_id=370002 BLCSL_RS13915 WP_003183444.1 2644398..2644574(+) (sinI) [Bacillus licheniformis strain CSL2]
ATGAATAAAGATAAAAATGAGAAAGAAGAATTGGATGAGGAGTGGACAGACTTGATTAAACACGCTCTTGAACAAGGCAT
TAGTCCAGAGGAAATACGTATTTTTCTCAATTTGGGAAAGAAGTCTTCAAATCCTTCCACATCAATTGAAAGAAGTCATT
CAATAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

51.724

100

0.517

Multiple sequence alignment