Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinR   Type   Regulator
Locus tag   FJM75_RS11845 Genome accession   NZ_CP041063
Coordinates   2378943..2379278 (+) Length   111 a.a.
NCBI ID   WP_160918186.1    Uniprot ID   -
Organism   Bacillus sp. Cs-700     
Function   repression of rok; repression of degU; repression of spo0A (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2351958..2386843 2378943..2379278 within 0


Gene organization within MGE regions


Location: 2351958..2386843
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FJM75_RS11775 - 2351958..2353322 (-) 1365 WP_165998571.1 cell wall-binding repeat-containing protein -
  FJM75_RS11780 - 2353672..2355321 (-) 1650 WP_165998573.1 peptidoglycan-binding protein -
  FJM75_RS11785 - 2355561..2358305 (-) 2745 WP_165998575.1 cell wall-binding repeat-containing protein -
  FJM75_RS11790 - 2358444..2360186 (-) 1743 WP_165998576.1 cell wall-binding repeat-containing protein -
  FJM75_RS11795 - 2360357..2361976 (-) 1620 WP_165998578.1 cell wall-binding repeat-containing protein -
  FJM75_RS11800 - 2362125..2364575 (-) 2451 WP_165998580.1 cell wall-binding repeat-containing protein -
  FJM75_RS11805 - 2364681..2368652 (-) 3972 WP_242688430.1 cell wall-binding repeat-containing protein -
  FJM75_RS11810 - 2369192..2370049 (-) 858 WP_165998582.1 DNA-processing protein DprA -
  FJM75_RS11815 - 2370096..2370713 (-) 618 WP_242688431.1 transposase -
  FJM75_RS11820 - 2371067..2376586 (-) 5520 WP_165998584.1 alpha amylase N-terminal ig-like domain-containing protein -
  FJM75_RS11825 - 2376753..2377139 (-) 387 WP_165998587.1 VOC family protein -
  FJM75_RS11830 - 2377212..2377985 (-) 774 WP_165998589.1 SDR family NAD(P)-dependent oxidoreductase -
  FJM75_RS11835 - 2378067..2378360 (-) 294 WP_165998591.1 hypothetical protein -
  FJM75_RS11840 - 2378710..2378829 (+) 120 WP_165998593.1 anti-repressor SinI family protein -
  FJM75_RS11845 sinR 2378943..2379278 (+) 336 WP_160918186.1 helix-turn-helix domain-containing protein Regulator
  FJM75_RS11850 - 2379542..2379808 (-) 267 WP_165998594.1 hypothetical protein -
  FJM75_RS11855 - 2379818..2379940 (-) 123 WP_098445358.1 anti-repressor SinI family protein -
  FJM75_RS11860 sinR 2380244..2380585 (+) 342 WP_165998596.1 helix-turn-helix domain-containing protein Regulator
  FJM75_RS11865 - 2380621..2380794 (-) 174 WP_165998598.1 hypothetical protein -
  FJM75_RS11870 fabZ 2381013..2381435 (-) 423 WP_098445360.1 3-hydroxyacyl-ACP dehydratase FabZ -
  FJM75_RS11875 - 2381454..2381738 (-) 285 WP_165998600.1 DNA-directed RNA polymerase subunit beta -
  FJM75_RS11880 - 2381775..2382776 (-) 1002 WP_098445362.1 rod shape-determining protein -
  FJM75_RS11885 spoIIID 2382916..2383188 (-) 273 WP_048311390.1 sporulation transcriptional regulator SpoIIID -
  FJM75_RS11890 - 2383517..2385178 (-) 1662 WP_165998601.1 sodium:solute symporter family protein -
  FJM75_RS11895 - 2385191..2385490 (-) 300 WP_165998603.1 sodium/substrate symporter small subunit -
  FJM75_RS11900 - 2385941..2386843 (-) 903 WP_160918193.1 M23 family metallopeptidase -

Sequence

Protein


Download         Length: 111 a.a.        Molecular weight: 12723.46 Da        Isoelectric Point: 5.9264

>NTDB_id=369244 FJM75_RS11845 WP_160918186.1 2378943..2379278(+) (sinR) [Bacillus sp. Cs-700]
MIGEEVKKYRLRKGLSLSELAERANVAKSYLSSIERNIQSNPSIQFLDKISNVLDVSVEVLLQGDDPIHQSELDAEWKKL
VKEAMESGVSKDQFKEFLEFNKWRAKQGPNQ

Nucleotide


Download         Length: 336 bp        

>NTDB_id=369244 FJM75_RS11845 WP_160918186.1 2378943..2379278(+) (sinR) [Bacillus sp. Cs-700]
GTGATCGGAGAAGAAGTTAAGAAGTATCGTTTACGCAAAGGGTTATCACTTTCAGAGCTAGCAGAACGCGCCAACGTTGC
TAAATCGTATTTAAGTTCCATTGAACGAAATATACAATCAAATCCCTCTATTCAATTTCTTGATAAAATATCGAATGTAT
TGGACGTTTCAGTCGAAGTACTTCTTCAAGGGGATGATCCTATTCACCAAAGTGAATTAGACGCTGAATGGAAGAAATTA
GTGAAGGAAGCTATGGAGTCCGGTGTTAGTAAAGATCAGTTCAAGGAATTTCTTGAATTTAATAAATGGCGCGCAAAACA
GGGGCCGAATCAATAA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(73-100)

Helix-turn-helix (HTH_3)

(6-60)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinR Bacillus subtilis subsp. subtilis str. 168

64.865

100

0.649

Multiple sequence alignment