Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | FHJ82_RS11615 | Genome accession | NZ_CP040881 |
| Coordinates | 2435627..2435800 (+) | Length | 57 a.a. |
| NCBI ID | WP_032874029.1 | Uniprot ID | - |
| Organism | Bacillus sp. HNA3 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2430627..2440800
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FHJ82_RS11600 (FHJ82_11735) | gcvT | 2431441..2432541 (-) | 1101 | WP_032874033.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| FHJ82_RS11605 (FHJ82_11740) | - | 2432964..2434634 (+) | 1671 | WP_032874031.1 | SNF2-related protein | - |
| FHJ82_RS11610 (FHJ82_11745) | - | 2434656..2435450 (+) | 795 | WP_007612541.1 | YqhG family protein | - |
| FHJ82_RS11615 (FHJ82_11750) | sinI | 2435627..2435800 (+) | 174 | WP_032874029.1 | anti-repressor SinI family protein | Regulator |
| FHJ82_RS11620 (FHJ82_11755) | sinR | 2435834..2436169 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| FHJ82_RS11625 (FHJ82_11760) | - | 2436217..2437002 (-) | 786 | WP_032874027.1 | TasA family protein | - |
| FHJ82_RS11630 (FHJ82_11765) | - | 2437067..2437651 (-) | 585 | WP_032874025.1 | signal peptidase I | - |
| FHJ82_RS11635 (FHJ82_11770) | tapA | 2437623..2438294 (-) | 672 | WP_032874023.1 | amyloid fiber anchoring/assembly protein TapA | - |
| FHJ82_RS11640 (FHJ82_11775) | - | 2438553..2438882 (+) | 330 | WP_032874021.1 | DUF3889 domain-containing protein | - |
| FHJ82_RS11645 (FHJ82_11780) | - | 2438923..2439102 (-) | 180 | WP_022552966.1 | YqzE family protein | - |
| FHJ82_RS11650 (FHJ82_11785) | comGG | 2439159..2439536 (-) | 378 | WP_032874019.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| FHJ82_RS11655 (FHJ82_11790) | comGF | 2439537..2440037 (-) | 501 | WP_223204419.1 | competence type IV pilus minor pilin ComGF | - |
| FHJ82_RS11660 (FHJ82_11795) | comGE | 2439946..2440260 (-) | 315 | WP_032874016.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| FHJ82_RS11665 (FHJ82_11800) | comGD | 2440244..2440681 (-) | 438 | WP_007612572.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6658.66 Da Isoelectric Point: 9.8168
>NTDB_id=367940 FHJ82_RS11615 WP_032874029.1 2435627..2435800(+) (sinI) [Bacillus sp. HNA3]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHVQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHVQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=367940 FHJ82_RS11615 WP_032874029.1 2435627..2435800(+) (sinI) [Bacillus sp. HNA3]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATGTCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATGTCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
71.93 |
100 |
0.719 |