Detailed information
Bioinformatically predicted
Overview
| Name | abrB | Type | Regulator |
| Locus tag | FHP15_RS11720 | Genome accession | NZ_CP040880 |
| Coordinates | 2023834..2024112 (+) | Length | 92 a.a. |
| NCBI ID | WP_000799086.1 | Uniprot ID | A0A7D8D6B3 |
| Organism | Bacillus paranthracis strain F3351/87 | ||
| Function | repression of comK; repression of rok (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2015086..2059796 | 2023834..2024112 | within | 0 |
Gene organization within MGE regions
Location: 2015086..2059796
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FHP15_RS11650 (FHP15_11610) | - | 2015086..2015613 (+) | 528 | WP_000460208.1 | hypothetical protein | - |
| FHP15_RS11655 (FHP15_11615) | - | 2015633..2016802 (+) | 1170 | WP_000588613.1 | DEAD/DEAH box helicase | - |
| FHP15_RS11660 (FHP15_11620) | - | 2016926..2017102 (+) | 177 | Protein_1959 | VOC family protein | - |
| FHP15_RS11665 (FHP15_11625) | - | 2017185..2018294 (-) | 1110 | WP_000675867.1 | tyrosine-type recombinase/integrase | - |
| FHP15_RS11670 (FHP15_11630) | - | 2018593..2019786 (+) | 1194 | WP_000803132.1 | AimR family lysis-lysogeny pheromone receptor | - |
| FHP15_RS11675 | - | 2020024..2020158 (+) | 135 | WP_000650968.1 | hypothetical protein | - |
| FHP15_RS11680 (FHP15_11635) | - | 2020195..2020548 (-) | 354 | WP_000481767.1 | helix-turn-helix transcriptional regulator | - |
| FHP15_RS11685 (FHP15_11640) | - | 2020750..2020935 (+) | 186 | WP_000854265.1 | helix-turn-helix transcriptional regulator | - |
| FHP15_RS11690 (FHP15_11645) | - | 2021091..2021366 (+) | 276 | WP_033670234.1 | helix-turn-helix domain-containing protein | - |
| FHP15_RS11695 | - | 2021422..2021586 (+) | 165 | WP_000390319.1 | hypothetical protein | - |
| FHP15_RS11700 | - | 2021616..2021792 (+) | 177 | WP_001241127.1 | hypothetical protein | - |
| FHP15_RS11705 (FHP15_11650) | - | 2021797..2022681 (+) | 885 | WP_001151930.1 | conserved phage C-terminal domain-containing protein | - |
| FHP15_RS11710 (FHP15_11655) | - | 2022696..2023610 (+) | 915 | WP_001171109.1 | AAA family ATPase | - |
| FHP15_RS11715 (FHP15_11660) | - | 2023623..2023817 (+) | 195 | WP_000338031.1 | hypothetical protein | - |
| FHP15_RS11720 (FHP15_11665) | abrB | 2023834..2024112 (+) | 279 | WP_000799086.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Regulator |
| FHP15_RS11725 (FHP15_11670) | - | 2024105..2024464 (+) | 360 | WP_001125952.1 | hypothetical protein | - |
| FHP15_RS11730 (FHP15_11675) | - | 2024483..2024650 (+) | 168 | WP_000717826.1 | DUF3954 domain-containing protein | - |
| FHP15_RS11735 (FHP15_11680) | - | 2024676..2024927 (+) | 252 | WP_000109486.1 | hypothetical protein | - |
| FHP15_RS11740 (FHP15_11685) | - | 2024947..2025429 (+) | 483 | WP_001102009.1 | nucleoside triphosphate pyrophosphohydrolase family protein | - |
| FHP15_RS11745 (FHP15_11690) | - | 2025632..2025901 (+) | 270 | WP_000397935.1 | hypothetical protein | - |
| FHP15_RS11750 (FHP15_11695) | - | 2026062..2026607 (+) | 546 | WP_001030638.1 | hypothetical protein | - |
| FHP15_RS11755 | - | 2026635..2026994 (+) | 360 | Protein_1978 | YopX family protein | - |
| FHP15_RS11760 | - | 2027004..2027309 (+) | 306 | WP_033679841.1 | hypothetical protein | - |
| FHP15_RS11765 (FHP15_11705) | - | 2027457..2027624 (+) | 168 | WP_000600761.1 | hypothetical protein | - |
| FHP15_RS11770 (FHP15_11710) | - | 2027661..2028059 (+) | 399 | WP_015992803.1 | YopX family protein | - |
| FHP15_RS11775 (FHP15_11715) | - | 2028376..2028597 (+) | 222 | WP_001216585.1 | hypothetical protein | - |
| FHP15_RS11780 (FHP15_11720) | - | 2029123..2029842 (+) | 720 | WP_000243721.1 | NUMOD4 domain-containing protein | - |
| FHP15_RS11785 (FHP15_11725) | - | 2029881..2030144 (+) | 264 | WP_000678894.1 | hypothetical protein | - |
| FHP15_RS11790 (FHP15_11730) | - | 2030367..2030615 (+) | 249 | WP_000033083.1 | helix-turn-helix transcriptional regulator | - |
| FHP15_RS11795 (FHP15_11735) | - | 2030938..2031069 (+) | 132 | WP_001061241.1 | DUF3983 domain-containing protein | - |
| FHP15_RS11800 | - | 2031174..2031344 (+) | 171 | WP_000645945.1 | hypothetical protein | - |
| FHP15_RS11805 (FHP15_11740) | - | 2031368..2031841 (+) | 474 | WP_001209121.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| FHP15_RS11810 (FHP15_11745) | - | 2031838..2032380 (+) | 543 | WP_001055139.1 | tyrosine-type recombinase/integrase | - |
| FHP15_RS11815 (FHP15_11755) | - | 2032981..2033355 (+) | 375 | WP_000443968.1 | hypothetical protein | - |
| FHP15_RS11820 (FHP15_11760) | - | 2033348..2033602 (+) | 255 | WP_000002729.1 | hypothetical protein | - |
| FHP15_RS11825 (FHP15_11765) | - | 2033626..2033838 (+) | 213 | WP_000761540.1 | hypothetical protein | - |
| FHP15_RS11830 | - | 2033971..2034144 (+) | 174 | WP_000333204.1 | hypothetical protein | - |
| FHP15_RS11835 | - | 2034137..2034499 (+) | 363 | WP_001008170.1 | HNH endonuclease signature motif containing protein | - |
| FHP15_RS11840 (FHP15_11775) | - | 2034660..2035040 (+) | 381 | WP_000357495.1 | phage terminase small subunit P27 family | - |
| FHP15_RS11845 (FHP15_11780) | - | 2035021..2036793 (+) | 1773 | WP_000633618.1 | terminase large subunit | - |
| FHP15_RS11850 (FHP15_11785) | - | 2036809..2038023 (+) | 1215 | WP_000767176.1 | phage portal protein | - |
| FHP15_RS11855 (FHP15_11790) | - | 2038001..2038756 (+) | 756 | WP_001107318.1 | head maturation protease, ClpP-related | - |
| FHP15_RS11860 (FHP15_11795) | - | 2038753..2039940 (+) | 1188 | WP_000782636.1 | phage major capsid protein | - |
| FHP15_RS11865 (FHP15_11800) | - | 2039966..2040217 (+) | 252 | Protein_2000 | fibronectin type III domain-containing protein | - |
| FHP15_RS11870 (FHP15_11805) | - | 2040226..2040501 (+) | 276 | WP_000891191.1 | head-tail connector protein | - |
| FHP15_RS11875 (FHP15_11810) | - | 2040488..2040835 (+) | 348 | WP_001069940.1 | phage head closure protein | - |
| FHP15_RS11880 (FHP15_11815) | - | 2040823..2041260 (+) | 438 | WP_000852722.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| FHP15_RS11885 (FHP15_11820) | - | 2041257..2041616 (+) | 360 | WP_001211423.1 | hypothetical protein | - |
| FHP15_RS11890 (FHP15_11825) | - | 2041630..2042214 (+) | 585 | WP_000952020.1 | major tail protein | - |
| FHP15_RS11895 (FHP15_11830) | - | 2042274..2042669 (+) | 396 | WP_001157384.1 | hypothetical protein | - |
| FHP15_RS11900 (FHP15_11835) | - | 2042687..2042827 (+) | 141 | WP_000938712.1 | hypothetical protein | - |
| FHP15_RS11905 (FHP15_11840) | - | 2042843..2047858 (+) | 5016 | WP_000896623.1 | phage tail tape measure protein | - |
| FHP15_RS11910 (FHP15_11845) | - | 2047895..2049367 (+) | 1473 | WP_000094085.1 | distal tail protein Dit | - |
| FHP15_RS11915 (FHP15_11850) | - | 2049364..2053389 (+) | 4026 | WP_001260174.1 | phage tail spike protein | - |
| FHP15_RS11920 (FHP15_11855) | - | 2053515..2054210 (+) | 696 | WP_000434602.1 | hypothetical protein | - |
| FHP15_RS11925 (FHP15_11860) | - | 2054418..2055377 (+) | 960 | WP_000822837.1 | tyrosine-type recombinase/integrase | - |
| FHP15_RS11930 (FHP15_11865) | - | 2055392..2055673 (+) | 282 | WP_000151211.1 | hypothetical protein | - |
| FHP15_RS11935 (FHP15_11870) | - | 2055676..2055882 (+) | 207 | WP_000159644.1 | hypothetical protein | - |
| FHP15_RS11940 (FHP15_11875) | - | 2055882..2056691 (+) | 810 | WP_000542512.1 | GH25 family lysozyme | - |
| FHP15_RS11945 (FHP15_11880) | - | 2056747..2056953 (-) | 207 | WP_000340446.1 | helix-turn-helix domain-containing protein | - |
| FHP15_RS11950 (FHP15_11885) | - | 2057258..2057650 (+) | 393 | WP_000427397.1 | hypothetical protein | - |
| FHP15_RS11955 (FHP15_11890) | - | 2057663..2057989 (+) | 327 | WP_000488699.1 | hypothetical protein | - |
| FHP15_RS11960 (FHP15_11895) | - | 2057999..2059156 (+) | 1158 | WP_002027563.1 | FtsK/SpoIIIE domain-containing protein | - |
| FHP15_RS11965 (FHP15_11900) | - | 2059146..2059796 (+) | 651 | WP_049779133.1 | replication-relaxation family protein | - |
Sequence
Protein
Download Length: 92 a.a. Molecular weight: 10030.62 Da Isoelectric Point: 8.0774
>NTDB_id=367874 FHP15_RS11720 WP_000799086.1 2023834..2024112(+) (abrB) [Bacillus paranthracis strain F3351/87]
MKNTGVARKVDELGRVVIPVELRRTLGIAEGTALNFHVDGENIVLRKHEKSCFVTGEVSESNMELLGGRMFLSKAGANEL
LNALEKSVKVHA
MKNTGVARKVDELGRVVIPVELRRTLGIAEGTALNFHVDGENIVLRKHEKSCFVTGEVSESNMELLGGRMFLSKAGANEL
LNALEKSVKVHA
Nucleotide
Download Length: 279 bp
>NTDB_id=367874 FHP15_RS11720 WP_000799086.1 2023834..2024112(+) (abrB) [Bacillus paranthracis strain F3351/87]
ATGAAAAATACAGGTGTTGCAAGAAAAGTAGATGAACTAGGGCGTGTAGTAATTCCAGTAGAGTTACGCAGAACTTTGGG
GATTGCTGAAGGAACAGCATTAAACTTTCATGTTGATGGGGAAAACATCGTTTTAAGAAAACATGAAAAGTCATGTTTTG
TAACAGGTGAAGTTTCTGAATCAAACATGGAATTGTTAGGTGGTCGAATGTTTTTGAGTAAGGCGGGAGCAAATGAGTTA
CTTAATGCTCTTGAAAAGAGCGTGAAGGTACATGCCTAA
ATGAAAAATACAGGTGTTGCAAGAAAAGTAGATGAACTAGGGCGTGTAGTAATTCCAGTAGAGTTACGCAGAACTTTGGG
GATTGCTGAAGGAACAGCATTAAACTTTCATGTTGATGGGGAAAACATCGTTTTAAGAAAACATGAAAAGTCATGTTTTG
TAACAGGTGAAGTTTCTGAATCAAACATGGAATTGTTAGGTGGTCGAATGTTTTTGAGTAAGGCGGGAGCAAATGAGTTA
CTTAATGCTCTTGAAAAGAGCGTGAAGGTACATGCCTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| abrB | Bacillus subtilis subsp. subtilis str. 168 |
54.945 |
98.913 |
0.543 |