Detailed information    

insolico Bioinformatically predicted

Overview

Name   nucA/comI   Type   Machinery gene
Locus tag   FGY93_RS19710 Genome accession   NZ_CP040829
Coordinates   4457955..4458380 (+) Length   141 a.a.
NCBI ID   WP_126666545.1    Uniprot ID   -
Organism   Paenibacillus polymyxa strain ZF129     
Function   cleavage of dsDNA into ssDNA (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Genomic island 4444299..4474018 4457955..4458380 within 0


Gene organization within MGE regions


Location: 4444299..4474018
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FGY93_RS19635 (FGY93_19635) - 4444299..4444871 (-) 573 WP_225164764.1 TetR/AcrR family transcriptional regulator -
  FGY93_RS19640 (FGY93_19640) - 4445016..4445696 (+) 681 WP_025365059.1 SDR family oxidoreductase -
  FGY93_RS19645 (FGY93_19645) abc-f 4445976..4447463 (-) 1488 WP_113050213.1 ribosomal protection-like ABC-F family protein -
  FGY93_RS19650 (FGY93_19650) - 4447998..4448267 (+) 270 WP_126666551.1 phage holin family protein -
  FGY93_RS19660 (FGY93_19660) - 4448942..4449328 (+) 387 WP_126666550.1 hypothetical protein -
  FGY93_RS19665 (FGY93_19665) - 4449331..4450734 (+) 1404 WP_126666549.1 hypothetical protein -
  FGY93_RS19670 (FGY93_19670) - 4450736..4451977 (+) 1242 WP_126666548.1 hypothetical protein -
  FGY93_RS19675 (FGY93_19675) - 4452771..4453001 (+) 231 WP_218975343.1 hypothetical protein -
  FGY93_RS19680 (FGY93_19680) - 4453151..4453542 (+) 392 Protein_3781 NucA/NucB deoxyribonuclease domain-containing protein -
  FGY93_RS19685 (FGY93_19685) - 4453660..4454112 (-) 453 WP_107733496.1 hypothetical protein -
  FGY93_RS19690 (FGY93_19690) - 4454356..4455771 (+) 1416 WP_126666547.1 helix-turn-helix transcriptional regulator -
  FGY93_RS26430 (FGY93_19695) - 4455964..4456175 (+) 212 Protein_3784 hypothetical protein -
  FGY93_RS19700 (FGY93_19700) - 4456228..4456647 (+) 420 WP_126666546.1 hypothetical protein -
  FGY93_RS19705 (FGY93_19705) - 4456834..4457723 (-) 890 Protein_3786 SPRY domain-containing protein -
  FGY93_RS19710 (FGY93_19710) nucA/comI 4457955..4458380 (+) 426 WP_126666545.1 NucA/NucB deoxyribonuclease domain-containing protein Machinery gene
  FGY93_RS26435 - 4458557..4458865 (+) 309 WP_228552641.1 hypothetical protein -
  FGY93_RS19715 (FGY93_19715) - 4458858..4459631 (+) 774 WP_228552640.1 fibronectin type III domain-containing protein -
  FGY93_RS19720 (FGY93_19720) - 4459681..4459893 (-) 213 WP_126666557.1 hypothetical protein -
  FGY93_RS19725 (FGY93_19725) - 4460342..4460887 (+) 546 WP_126666544.1 GNAT family N-acetyltransferase -
  FGY93_RS19730 (FGY93_19730) - 4461230..4461409 (+) 180 Protein_3792 helix-turn-helix transcriptional regulator -
  FGY93_RS19735 (FGY93_19735) - 4461595..4461915 (-) 321 WP_090890505.1 hypothetical protein -
  FGY93_RS19745 (FGY93_19745) - 4462939..4463253 (-) 315 WP_031461602.1 multidrug efflux SMR transporter -
  FGY93_RS19750 (FGY93_19750) - 4463250..4463588 (-) 339 WP_016821963.1 multidrug efflux SMR transporter -
  FGY93_RS26440 - 4464000..4464095 (+) 96 WP_016821962.1 hypothetical protein -
  FGY93_RS26655 - 4464340..4464465 (+) 126 WP_257125939.1 hypothetical protein -
  FGY93_RS19755 (FGY93_19755) - 4464708..4464815 (+) 108 WP_016821960.1 hypothetical protein -
  FGY93_RS19760 (FGY93_19760) - 4465012..4466481 (-) 1470 WP_225164762.1 FAD-binding protein -
  FGY93_RS19765 (FGY93_19765) - 4466894..4467775 (+) 882 WP_025365048.1 glycosyltransferase -
  FGY93_RS26445 (FGY93_19770) - 4467968..4468069 (+) 102 WP_016821957.1 hypothetical protein -
  FGY93_RS19775 (FGY93_19775) - 4468386..4469798 (+) 1413 WP_025365047.1 helix-turn-helix transcriptional regulator -
  FGY93_RS19780 (FGY93_19780) - 4470079..4470459 (+) 381 WP_025365046.1 hypothetical protein -
  FGY93_RS19785 (FGY93_19785) - 4470857..4471735 (-) 879 WP_045244482.1 SDR family NAD(P)-dependent oxidoreductase -
  FGY93_RS19790 (FGY93_19790) - 4471891..4472364 (+) 474 WP_016821954.1 MarR family winged helix-turn-helix transcriptional regulator -
  FGY93_RS19795 (FGY93_19795) - 4472579..4473061 (+) 483 WP_228552592.1 hypothetical protein -
  FGY93_RS19800 (FGY93_19800) - 4473518..4474018 (+) 501 WP_117289551.1 DUF2798 domain-containing protein -

Sequence

Protein


Download         Length: 141 a.a.        Molecular weight: 15350.34 Da        Isoelectric Point: 6.7126

>NTDB_id=367511 FGY93_RS19710 WP_126666545.1 4457955..4458380(+) (nucA/comI) [Paenibacillus polymyxa strain ZF129]
MIKGILRGLIVFLLAAIFSVQGVFAEPTAISQQAAGYTLEFPSSRYPETGAHIRDAIANGHSAVCTIDRDGAEENRKESL
KGYPTKKGYDRDEWPMAMCAEGGAGADIRYITPSDNRGAGSWVSHQLDKYDDGTKVRLIVK

Nucleotide


Download         Length: 426 bp        

>NTDB_id=367511 FGY93_RS19710 WP_126666545.1 4457955..4458380(+) (nucA/comI) [Paenibacillus polymyxa strain ZF129]
ATGATAAAAGGAATCTTAAGAGGATTAATTGTATTTTTACTAGCTGCTATTTTTTCCGTTCAAGGCGTCTTTGCTGAACC
GACAGCAATTAGTCAACAAGCAGCTGGGTATACGTTAGAGTTTCCAAGTTCACGCTACCCTGAAACCGGAGCACACATAA
GGGATGCTATTGCAAACGGACATTCTGCTGTATGTACCATTGATCGAGATGGGGCAGAGGAGAATAGGAAGGAATCTTTA
AAGGGCTATCCAACTAAAAAAGGATATGACCGAGATGAATGGCCAATGGCAATGTGTGCAGAAGGTGGCGCAGGTGCTGA
TATAAGATACATAACCCCTAGTGATAATCGGGGAGCAGGATCATGGGTAAGTCATCAGTTAGATAAGTATGATGATGGTA
CAAAGGTAAGACTCATAGTGAAATAA

Domains

Predicted by InterproScan.

Deoxyribonuclease NucA/NucB (DNase_NucA_NucB)

(44-138)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  nucA/comI Bacillus subtilis subsp. subtilis str. 168

61.29

87.943

0.539

Multiple sequence alignment