Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   BPGQ101_RS15620 Genome accession   NZ_CP040514
Coordinates   2975970..2976110 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus altitudinis strain GQYP101     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2970970..2981110
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BPGQ101_RS15595 (BPGQ101_15595) - 2971236..2971625 (-) 390 WP_017358943.1 hotdog fold thioesterase -
  BPGQ101_RS15600 (BPGQ101_15600) comA 2971649..2972290 (-) 642 WP_007500477.1 response regulator transcription factor Regulator
  BPGQ101_RS15605 (BPGQ101_15605) comP 2972371..2974683 (-) 2313 WP_045034542.1 ATP-binding protein Regulator
  BPGQ101_RS15610 (BPGQ101_15610) comX 2974737..2974907 (-) 171 WP_080673854.1 competence pheromone ComX -
  BPGQ101_RS15615 (BPGQ101_15615) - 2974904..2975818 (-) 915 WP_035701208.1 polyprenyl synthetase family protein -
  BPGQ101_RS15620 (BPGQ101_15620) degQ 2975970..2976110 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  BPGQ101_RS15625 (BPGQ101_15625) - 2976616..2976969 (+) 354 WP_017367963.1 hypothetical protein -
  BPGQ101_RS15630 (BPGQ101_15630) - 2977006..2978232 (-) 1227 WP_135009815.1 EAL and HDOD domain-containing protein -
  BPGQ101_RS15635 (BPGQ101_15635) - 2978373..2979842 (-) 1470 WP_007500472.1 nicotinate phosphoribosyltransferase -
  BPGQ101_RS15640 (BPGQ101_15640) - 2979860..2980411 (-) 552 WP_046526549.1 cysteine hydrolase family protein -
  BPGQ101_RS15645 (BPGQ101_15645) - 2980472..2980879 (-) 408 WP_024719733.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=364835 BPGQ101_RS15620 WP_003213123.1 2975970..2976110(-) (degQ) [Bacillus altitudinis strain GQYP101]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=364835 BPGQ101_RS15620 WP_003213123.1 2975970..2976110(-) (degQ) [Bacillus altitudinis strain GQYP101]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAACTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696

Multiple sequence alignment