Detailed information
Bioinformatically predicted
Overview
| Name | abrB | Type | Regulator |
| Locus tag | EUC38_RS15675 | Genome accession | NZ_CP040340 |
| Coordinates | 3089495..3089773 (+) | Length | 92 a.a. |
| NCBI ID | WP_000842216.1 | Uniprot ID | A0A9W5QHH7 |
| Organism | Bacillus cereus strain DLOU-Tangshan | ||
| Function | repression of comK; repression of rok (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 3050461..3088695 | 3089495..3089773 | flank | 800 |
Gene organization within MGE regions
Location: 3050461..3089773
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EUC38_RS15470 | - | 3051115..3051387 (-) | 273 | Protein_3008 | DUF1232 domain-containing protein | - |
| EUC38_RS30590 | - | 3051615..3051797 (-) | 183 | Protein_3009 | hypothetical protein | - |
| EUC38_RS15475 | - | 3051991..3052251 (+) | 261 | WP_000513517.1 | hypothetical protein | - |
| EUC38_RS15480 | - | 3052424..3053110 (+) | 687 | WP_000691158.1 | MBL fold metallo-hydrolase | - |
| EUC38_RS15485 | - | 3053270..3053539 (+) | 270 | WP_144653353.1 | hypothetical protein | - |
| EUC38_RS15490 | - | 3053613..3054989 (+) | 1377 | WP_002025792.1 | DEAD/DEAH box helicase | - |
| EUC38_RS15495 | - | 3056347..3056559 (-) | 213 | WP_000033157.1 | hypothetical protein | - |
| EUC38_RS15500 | - | 3057045..3057680 (+) | 636 | WP_001223581.1 | TetR/AcrR family transcriptional regulator | - |
| EUC38_RS15505 | - | 3057745..3058989 (+) | 1245 | WP_140387079.1 | MFS transporter | - |
| EUC38_RS30225 | - | 3058996..3059642 (+) | 647 | Protein_3017 | ABC transporter permease | - |
| EUC38_RS15515 | - | 3059731..3060185 (+) | 455 | Protein_3018 | nucleoside triphosphate pyrophosphohydrolase family protein | - |
| EUC38_RS30230 | - | 3060417..3060825 (-) | 409 | Protein_3019 | DUF4870 domain-containing protein | - |
| EUC38_RS15520 | - | 3060901..3061392 (-) | 492 | WP_000087352.1 | exosporium leader peptide-containing protein | - |
| EUC38_RS15525 | - | 3061702..3062166 (-) | 465 | WP_001010965.1 | hypothetical protein | - |
| EUC38_RS15530 | - | 3062359..3063090 (-) | 732 | WP_000546544.1 | hypothetical protein | - |
| EUC38_RS15535 | - | 3063333..3063797 (-) | 465 | WP_000796389.1 | hypothetical protein | - |
| EUC38_RS30235 | - | 3065002..3065301 (-) | 300 | WP_000682208.1 | hypothetical protein | - |
| EUC38_RS29820 | - | 3065533..3065703 (+) | 171 | WP_001202055.1 | hypothetical protein | - |
| EUC38_RS15540 | - | 3065731..3066213 (+) | 483 | WP_000166128.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| EUC38_RS15545 | - | 3066213..3066755 (+) | 543 | WP_001012102.1 | site-specific integrase | - |
| EUC38_RS15550 | - | 3067088..3069052 (+) | 1965 | WP_140387080.1 | M6 family metalloprotease domain-containing protein | - |
| EUC38_RS15555 | - | 3069725..3069835 (+) | 111 | WP_000718602.1 | YjcZ family sporulation protein | - |
| EUC38_RS15560 | - | 3069876..3070001 (+) | 126 | WP_000718601.1 | YjcZ family sporulation protein | - |
| EUC38_RS15565 | - | 3070130..3070561 (+) | 432 | WP_000535863.1 | hypothetical protein | - |
| EUC38_RS30595 | - | 3070832..3071137 (+) | 306 | Protein_3032 | phage tail tape measure protein | - |
| EUC38_RS15575 | - | 3071179..3072858 (+) | 1680 | WP_002025803.1 | distal tail protein Dit | - |
| EUC38_RS15580 | - | 3073929..3074630 (+) | 702 | WP_001294982.1 | CsxC family protein | - |
| EUC38_RS15585 | - | 3074757..3075641 (+) | 885 | WP_000795504.1 | BC_2427 family protein | - |
| EUC38_RS15590 | - | 3076188..3076661 (-) | 474 | WP_000342722.1 | hypothetical protein | - |
| EUC38_RS30245 | - | 3077049..3077293 (+) | 245 | Protein_3037 | hypothetical protein | - |
| EUC38_RS15600 | - | 3077393..3078103 (+) | 711 | WP_000846112.1 | class I SAM-dependent methyltransferase | - |
| EUC38_RS15605 | - | 3078221..3078628 (+) | 408 | WP_000063587.1 | VOC family protein | - |
| EUC38_RS15610 | - | 3078652..3079032 (+) | 381 | Protein_3040 | SAM-dependent methyltransferase | - |
| EUC38_RS15615 | - | 3079190..3080875 (-) | 1686 | WP_088054504.1 | alpha-keto acid decarboxylase family protein | - |
| EUC38_RS15620 | - | 3080983..3081465 (+) | 483 | WP_000191888.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
| EUC38_RS15625 | gpmA | 3081632..3082369 (+) | 738 | WP_000594152.1 | 2,3-diphosphoglycerate-dependent phosphoglycerate mutase | - |
| EUC38_RS15630 | - | 3082608..3083345 (+) | 738 | WP_000624977.1 | type II toxin-antitoxin system SpoIISA family toxin | - |
| EUC38_RS15635 | - | 3083458..3083586 (+) | 129 | WP_000237819.1 | hypothetical protein | - |
| EUC38_RS15640 | spoIISB | 3083659..3083835 (+) | 177 | WP_000852629.1 | stage II sporulation protein SB | - |
| EUC38_RS15645 | - | 3083855..3084244 (-) | 390 | Protein_3047 | YxeA family protein | - |
| EUC38_RS15650 | pepD | 3084456..3085925 (+) | 1470 | WP_065382524.1 | beta-Ala-His dipeptidase | - |
| EUC38_RS15655 | - | 3086171..3086980 (+) | 810 | WP_000678370.1 | papain-like cysteine protease family protein | - |
| EUC38_RS15660 | - | 3087006..3087608 (+) | 603 | WP_000517271.1 | hypothetical protein | - |
| EUC38_RS15665 | - | 3087852..3088103 (-) | 252 | WP_000827560.1 | LuxR C-terminal-related transcriptional regulator | - |
| EUC38_RS15670 | - | 3088478..3089355 (+) | 878 | Protein_3052 | helix-turn-helix domain-containing protein | - |
| EUC38_RS15675 | abrB | 3089495..3089773 (+) | 279 | WP_000842216.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Regulator |
Sequence
Protein
Download Length: 92 a.a. Molecular weight: 10378.28 Da Isoelectric Point: 10.0092
>NTDB_id=363413 EUC38_RS15675 WP_000842216.1 3089495..3089773(+) (abrB) [Bacillus cereus strain DLOU-Tangshan]
MKSRGITRKADSMGRIVIPMEIRRSLGIVEKDSLEMFIEEDQIILRKYQSPRACALTGDISDSNISLANGKIIVSPNGME
LLIKKLQQYLLK
MKSRGITRKADSMGRIVIPMEIRRSLGIVEKDSLEMFIEEDQIILRKYQSPRACALTGDISDSNISLANGKIIVSPNGME
LLIKKLQQYLLK
Nucleotide
Download Length: 279 bp
>NTDB_id=363413 EUC38_RS15675 WP_000842216.1 3089495..3089773(+) (abrB) [Bacillus cereus strain DLOU-Tangshan]
ATGAAATCAAGAGGAATTACTCGTAAAGCAGATAGCATGGGGCGTATTGTTATTCCAATGGAAATAAGACGGAGTTTAGG
AATTGTAGAAAAAGATTCTCTTGAAATGTTTATAGAAGAGGACCAGATTATTTTACGAAAATATCAATCTCCAAGAGCTT
GTGCACTTACAGGGGATATTTCAGACAGCAATATTTCGTTAGCGAATGGGAAGATTATTGTAAGTCCAAACGGGATGGAA
CTGTTAATAAAGAAGTTACAGCAATATCTTTTAAAATAA
ATGAAATCAAGAGGAATTACTCGTAAAGCAGATAGCATGGGGCGTATTGTTATTCCAATGGAAATAAGACGGAGTTTAGG
AATTGTAGAAAAAGATTCTCTTGAAATGTTTATAGAAGAGGACCAGATTATTTTACGAAAATATCAATCTCCAAGAGCTT
GTGCACTTACAGGGGATATTTCAGACAGCAATATTTCGTTAGCGAATGGGAAGATTATTGTAAGTCCAAACGGGATGGAA
CTGTTAATAAAGAAGTTACAGCAATATCTTTTAAAATAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| abrB | Bacillus subtilis subsp. subtilis str. 168 |
50 |
97.826 |
0.489 |