Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   GRT08_RS01985 Genome accession   NZ_CP047234
Coordinates   387227..387346 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   A7Z1C5
Organism   Bacillus amyloliquefaciens strain FJ4     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 382227..392346
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GRT08_RS01970 (GRT08_01955) - 383839..384522 (+) 684 WP_007410267.1 response regulator transcription factor -
  GRT08_RS01975 (GRT08_01960) - 384509..385942 (+) 1434 WP_182069772.1 HAMP domain-containing sensor histidine kinase -
  GRT08_RS01980 (GRT08_01965) rapC 386095..387243 (+) 1149 WP_003156336.1 Rap family tetratricopeptide repeat protein Regulator
  GRT08_RS01985 (GRT08_01970) phrC 387227..387346 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  GRT08_RS01990 (GRT08_01975) - 387497..387607 (-) 111 WP_369719092.1 YjcZ family sporulation protein -
  GRT08_RS01995 (GRT08_01980) - 387687..389051 (-) 1365 WP_101562697.1 aspartate kinase -
  GRT08_RS02000 (GRT08_01985) ceuB 389466..390419 (+) 954 WP_003156332.1 ABC transporter permease Machinery gene
  GRT08_RS02005 (GRT08_01990) - 390409..391356 (+) 948 WP_007410274.1 iron chelate uptake ABC transporter family permease subunit -
  GRT08_RS02010 (GRT08_01995) - 391350..392108 (+) 759 WP_071392129.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=358294 GRT08_RS01985 WP_003156334.1 387227..387346(+) (phrC) [Bacillus amyloliquefaciens strain FJ4]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=358294 GRT08_RS01985 WP_003156334.1 387227..387346(+) (phrC) [Bacillus amyloliquefaciens strain FJ4]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A7Z1C5

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718


Multiple sequence alignment