Detailed information    

insolico Bioinformatically predicted

Overview

Name   sxy/tfoX   Type   Regulator
Locus tag   ECO111_RS05395 Genome accession   NC_013364
Coordinates   1110340..1110924 (+) Length   194 a.a.
NCBI ID   WP_077825616.1    Uniprot ID   -
Organism   Escherichia coli O111:H- str. 11128     
Function   positive regulator of competence gene (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1094085..1132815 1110340..1110924 within 0


Gene organization within MGE regions


Location: 1094085..1132815
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ECO111_RS05325 (ECO111_1014) zapC 1095109..1095651 (+) 543 WP_001295353.1 cell division protein ZapC -
  ECO111_RS05330 (ECO111_1015) ycbX 1095648..1096757 (-) 1110 WP_000224312.1 6-N-hydroxylaminopurine resistance protein YcbX -
  ECO111_RS05335 (ECO111_1016) rlmKL 1097001..1099109 (+) 2109 WP_001086519.1 bifunctional 23S rRNA (guanine(2069)-N(7))-methyltransferase RlmK/23S rRNA (guanine(2445)-N(2))-methyltransferase RlmL -
  ECO111_RS05340 (ECO111_1017) uup 1099121..1101028 (+) 1908 WP_000053122.1 ABC transporter ATP-binding protein -
  ECO111_RS05345 (ECO111_1018) pqiA 1101158..1102411 (+) 1254 WP_000333176.1 membrane integrity-associated transporter subunit PqiA -
  ECO111_RS05350 (ECO111_1019) pqiB 1102416..1104056 (+) 1641 WP_000445533.1 intermembrane transport protein PqiB -
  ECO111_RS05355 (ECO111_1020) pqiC 1104053..1104616 (+) 564 WP_000759123.1 membrane integrity-associated transporter subunit PqiC -
  ECO111_RS05360 (ECO111_1021) rmf 1104872..1105039 (+) 168 WP_000828648.1 ribosome modulation factor -
  ECO111_RS05365 (ECO111_1022) fabA 1105109..1105627 (-) 519 WP_000227927.1 bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase -
  ECO111_RS05370 (ECO111_1023) ycbZ 1105696..1107456 (-) 1761 WP_000156529.1 AAA family ATPase -
  ECO111_RS05375 (ECO111_1024) matP 1107642..1108094 (+) 453 WP_000877161.1 macrodomain Ter protein MatP -
  ECO111_RS05380 (ECO111_1025) ompA 1108170..1109210 (-) 1041 WP_000750416.1 porin OmpA -
  ECO111_RS05390 (ECO111_1026) sulA 1109567..1110076 (-) 510 WP_000288710.1 SOS-induced cell division inhibitor SulA -
  ECO111_RS05395 (ECO111_1027) sxy/tfoX 1110340..1110924 (+) 585 WP_077825616.1 CRP-S regulon transcriptional coactivator Sxy Regulator
  ECO111_RS05400 (ECO111_1028) yccS 1110887..1113049 (-) 2163 WP_000875023.1 YccS family putative transporter -
  ECO111_RS05405 (ECO111_1029) yccF 1113059..1113505 (-) 447 WP_001261235.1 YccF domain-containing protein -
  ECO111_RS05410 (ECO111_1030) helD 1113628..1115682 (+) 2055 WP_001297106.1 DNA helicase IV -
  ECO111_RS05415 (ECO111_1031) mgsA 1115714..1116172 (-) 459 WP_000424181.1 methylglyoxal synthase -
  ECO111_RS05420 (ECO111_1032) yccT 1116268..1116930 (-) 663 WP_000847791.1 DUF2057 family protein -
  ECO111_RS05430 (ECO111_1033) yccU 1117103..1117516 (+) 414 WP_000665217.1 CoA-binding protein -
  ECO111_RS05435 (ECO111_1034) hspQ 1117561..1117878 (-) 318 WP_001295356.1 heat shock protein HspQ -
  ECO111_RS05440 (ECO111_1035) rlmI 1117936..1119126 (-) 1191 WP_000116302.1 23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI -
  ECO111_RS05445 (ECO111_1036) yccX 1119221..1119499 (+) 279 WP_000048244.1 acylphosphatase -
  ECO111_RS05450 (ECO111_1037) tusE 1119496..1119825 (-) 330 WP_000904442.1 sulfurtransferase TusE -
  ECO111_RS05455 (ECO111_1038) yccA 1119916..1120575 (-) 660 WP_000375138.1 FtsH protease modulator YccA -
  ECO111_RS05465 (ECO111_1040) - 1120983..1121998 (-) 1016 Protein_1045 tyrosine-type recombinase/integrase -
  ECO111_RS33600 (ECO111_1041) - 1121976..1122218 (-) 243 WP_000273151.1 DUF4224 domain-containing protein -
  ECO111_RS05475 (ECO111_1042) - 1122286..1123338 (-) 1053 Protein_1047 3'-5' exoribonuclease -
  ECO111_RS05490 (ECO111_1045) - 1124649..1126070 (-) 1422 Protein_1049 exonuclease -
  ECO111_RS05495 (ECO111_1046) - 1126163..1126354 (-) 192 WP_001090200.1 DUF1482 family protein -
  ECO111_RS05500 (ECO111_1047) dicB 1126351..1126539 (-) 189 WP_000449192.1 cell division inhibition protein DicB -
  ECO111_RS05505 (ECO111_1048) - 1127071..1127445 (-) 375 WP_000394557.1 hypothetical protein -
  ECO111_RS05510 - 1127457..1127609 (-) 153 WP_000379580.1 DUF1391 family protein -
  ECO111_RS05515 (ECO111_1050) - 1127882..1128598 (-) 717 WP_000103686.1 LexA family protein -
  ECO111_RS05520 (ECO111_1051) - 1128648..1128863 (+) 216 WP_000471549.1 Cro/CI family transcriptional regulator -
  ECO111_RS05525 (ECO111_1052) - 1128860..1129285 (+) 426 WP_000693949.1 toxin YdaT family protein -
  ECO111_RS05530 (ECO111_1053) - 1129357..1130427 (+) 1071 WP_001262389.1 hypothetical protein -
  ECO111_RS05535 (ECO111_1054) - 1130468..1130890 (+) 423 WP_001151153.1 DUF977 family protein -
  ECO111_RS05540 (ECO111_1055) - 1130887..1131183 (+) 297 WP_001266135.1 DUF4406 domain-containing protein -
  ECO111_RS05545 (ECO111_1056) - 1131180..1131641 (+) 462 WP_001209481.1 sigma-E factor regulatory protein RseB domain-containing protein -
  ECO111_RS05550 (ECO111_1057) - 1131619..1131975 (+) 357 WP_000403777.1 hypothetical protein -
  ECO111_RS05555 (ECO111_1058) - 1132026..1132238 (+) 213 WP_000935420.1 hypothetical protein -
  ECO111_RS05560 - 1132271..1132488 (+) 218 Protein_1063 DUF4014 family protein -
  ECO111_RS05565 (ECO111_1059) - 1132490..1132753 (+) 264 WP_000224233.1 hypothetical protein -

Sequence

Protein


Download         Length: 194 a.a.        Molecular weight: 22258.82 Da        Isoelectric Point: 8.4565

>NTDB_id=35387 ECO111_RS05395 WP_077825616.1 1110340..1110924(+) (sxy/tfoX) [Escherichia coli O111:H- str. 11128]
MATLGTIEYRSLFGSYSLTVDDTVFAMVSDGELYLRACEQSAQYCVKHPPVWLTYKKCGRSVTLNYYRVDESLWRNQLKL
VRLSKYSLDAALKEKSTRNTRERLKDLPNMSFHLEAILGEVGIKDVRALRILGAKMCWLRLRQQNSLVTEKILFMLEGAI
IGIHEAALPVARRQELAEWADSLTPKQEFPAELE

Nucleotide


Download         Length: 585 bp        

>NTDB_id=35387 ECO111_RS05395 WP_077825616.1 1110340..1110924(+) (sxy/tfoX) [Escherichia coli O111:H- str. 11128]
CTGGCAACGTTGGGCACAATTGAATACCGATCATTGTTTGGCAGTTACAGCCTGACCGTTGACGACACGGTGTTTGCGAT
GGTTTCTGATGGTGAGTTGTATCTTCGGGCTTGTGAGCAAAGTGCACAGTACTGTGTAAAACATCCGCCTGTCTGGCTGA
CATATAAAAAGTGTGGCCGATCCGTTACCCTCAATTACTATCGGGTTGATGAAAGTCTATGGCGAAATCAACTGAAGCTG
GTGCGTCTGTCGAAATATTCTCTCGATGCAGCGCTGAAAGAGAAAAGCACGCGCAATACCCGGGAAAGACTGAAAGATTT
GCCCAATATGTCTTTTCATCTGGAAGCGATTCTCGGGGAGGTGGGGATTAAGGATGTACGGGCGTTACGTATACTTGGGG
CAAAAATGTGTTGGTTGCGACTGCGGCAGCAAAACAGTCTGGTGACAGAAAAGATTCTGTTTATGCTTGAAGGTGCCATT
ATCGGCATTCATGAAGCTGCGCTCCCGGTGGCACGCCGCCAGGAGCTTGCAGAATGGGCTGACTCTCTTACGCCGAAACA
GGAGTTTCCTGCGGAACTTGAGTAA

Domains

Predicted by InterproScan.

TfoX C-terminal domain (TfoX_C)

(101-179)

TfoX N-terminal domain (TfoX_N)

(2-91)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sxy/tfoX Escherichia coli BW25113 strain K-12

99.485

100

0.995

Multiple sequence alignment