Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   GO005_RS16325 Genome accession   NZ_CP046592
Coordinates   3150564..3150704 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain TR21     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3145564..3155704
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GO005_RS16300 (GO005_16295) yuxO 3145841..3146221 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  GO005_RS16305 (GO005_16300) comA 3146240..3146884 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  GO005_RS16310 (GO005_16305) comP 3146965..3149277 (-) 2313 WP_032722435.1 histidine kinase Regulator
  GO005_RS16315 (GO005_16310) comX 3149293..3149514 (-) 222 WP_014480704.1 competence pheromone ComX -
  GO005_RS16320 (GO005_16315) comQ 3149516..3150379 (-) 864 WP_032722437.1 polyprenyl synthetase family protein Regulator
  GO005_RS16325 (GO005_16320) degQ 3150564..3150704 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  GO005_RS16330 (GO005_16325) - 3150926..3151051 (+) 126 WP_003228793.1 hypothetical protein -
  GO005_RS16335 (GO005_16330) - 3151165..3151533 (+) 369 WP_014477834.1 hypothetical protein -
  GO005_RS16340 (GO005_16335) pdeH 3151509..3152738 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  GO005_RS16345 (GO005_16340) pncB 3152875..3154347 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  GO005_RS16350 (GO005_16345) pncA 3154363..3154914 (-) 552 WP_014477836.1 isochorismatase family cysteine hydrolase -
  GO005_RS16355 (GO005_16350) yueI 3155011..3155409 (-) 399 WP_015251331.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=353797 GO005_RS16325 WP_003220708.1 3150564..3150704(-) (degQ) [Bacillus subtilis strain TR21]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=353797 GO005_RS16325 WP_003220708.1 3150564..3150704(-) (degQ) [Bacillus subtilis strain TR21]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1