Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   ES298_RS02590 Genome accession   NZ_CP038253
Coordinates   509230..509379 (+) Length   49 a.a.
NCBI ID   WP_001809846.1    Uniprot ID   Q00MV6
Organism   Streptococcus pneumoniae strain TVO_1901929     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
IScluster/Tn 507559..508363 509230..509379 flank 867


Gene organization within MGE regions


Location: 507559..509379
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ES298_RS02575 (ES298_02715) - 507559..508363 (+) 805 Protein_514 IS5 family transposase -
  ES298_RS02580 (ES298_02720) blpM 508513..508767 (+) 255 WP_000379879.1 two-peptide bacteriocin subunit BlpM -
  ES298_RS02585 (ES298_02725) blpN 508783..508986 (+) 204 WP_001099492.1 two-peptide bacteriocin subunit BlpN -
  ES298_RS02590 (ES298_02735) cipB 509230..509379 (+) 150 WP_001809846.1 bacteriocin-like peptide BlpO Regulator

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5149.92 Da        Isoelectric Point: 4.0439

>NTDB_id=352686 ES298_RS02590 WP_001809846.1 509230..509379(+) (cipB) [Streptococcus pneumoniae strain TVO_1901929]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=352686 ES298_RS02590 WP_001809846.1 509230..509379(+) (cipB) [Streptococcus pneumoniae strain TVO_1901929]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterproScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-44)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB Q00MV6

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

53.061

100

0.531

Multiple sequence alignment