Detailed information NTG0352530

Bioinformatically predicted

Overview

• Name: cipB
• Type: Regulator
• Locus tag: ES300_RS02500
• Genome accession: NZ_CP038251
• Coordinates: 495081..495230 (+)
• Length: 49 a.a.
• NCBI ID: WP_001818346.1
• Uniprot ID: -
• Organism: Streptococcus pneumoniae strain TVO_1901944
• Function: indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
IScluster/Tn	493410..497662	495081..495230	within	0

Gene organization within MGE regions

Location: 493410..497662

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ES300_RS02485 (ES300_02620)	-	493410..494214 (+)	805	WP_128903587.1	IS5 family transposase	-
ES300_RS02490 (ES300_02625)	blpM	494364..494618 (+)	255	WP_000379879.1	two-peptide bacteriocin subunit BlpM	-
ES300_RS02495 (ES300_02630)	blpN	494634..494837 (+)	204	WP_001099492.1	two-peptide bacteriocin subunit BlpN	-
ES300_RS02500 (ES300_02640)	cipB	495081..495230 (+)	150	WP_001818346.1	bacteriocin-like peptide BlpO	Regulator
ES300_RS10850	-	495266..495331 (+)	66	Protein_501	ComC/BlpC family peptide pheromone/bacteriocin	-
ES300_RS02505 (ES300_02645)	-	495334..495453 (+)	120	WP_000346296.1	PncF family bacteriocin immunity protein	-
ES300_RS02510 (ES300_02655)	-	496316..497662 (+)	1347	WP_001809444.1	IS1380-like element ISSpn5 family transposase	-

Sequence

Protein

• Length: 49 a.a.
• Molecular weight: 5134.91 Da
• Isoelectric Point: 3.9133

>NTDB_id=352530 ES300_RS02500 WP_001818346.1 495081..495230(+) (cipB) [Streptococcus pneumoniae strain TVO_1901944]
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide

• Length: 150 bp

>NTDB_id=352530 ES300_RS02500 WP_001818346.1 495081..495230(+) (cipB) [Streptococcus pneumoniae strain TVO_1901944]
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterproScan.

• Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc) (6-44)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
cipB	Streptococcus mutans UA159	51.02	100	0.51