Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   GFX43_RS05875 Genome accession   NZ_CP046448
Coordinates   1154233..1154373 (+) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain ZD01     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 1149233..1159373
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GFX43_RS05850 (GFX43_005850) yueI 1149527..1149925 (+) 399 WP_015483635.1 YueI family protein -
  GFX43_RS05855 (GFX43_005855) pncA 1150022..1150573 (+) 552 WP_014477836.1 isochorismatase family cysteine hydrolase -
  GFX43_RS05860 (GFX43_005860) pncB 1150589..1152061 (+) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  GFX43_RS05865 (GFX43_005865) pdeH 1152198..1153427 (+) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  GFX43_RS05870 (GFX43_005870) - 1153403..1153771 (-) 369 WP_015483634.1 hypothetical protein -
  GFX43_RS20655 - 1153949..1154011 (-) 63 Protein_1141 hypothetical protein -
  GFX43_RS05875 (GFX43_005875) degQ 1154233..1154373 (+) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  GFX43_RS05880 (GFX43_005880) comQ 1154558..1155418 (+) 861 WP_015483633.1 polyprenyl synthetase family protein Regulator
  GFX43_RS05885 (GFX43_005885) comX 1155431..1155595 (+) 165 WP_015384519.1 competence pheromone ComX -
  GFX43_RS05890 (GFX43_005890) comP 1155607..1157907 (+) 2301 WP_046340263.1 histidine kinase Regulator
  GFX43_RS05895 (GFX43_005895) comA 1157988..1158632 (+) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  GFX43_RS05900 (GFX43_005900) yuxO 1158650..1159030 (+) 381 WP_015483631.1 hotdog fold thioesterase -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=352341 GFX43_RS05875 WP_003220708.1 1154233..1154373(+) (degQ) [Bacillus subtilis strain ZD01]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=352341 GFX43_RS05875 WP_003220708.1 1154233..1154373(+) (degQ) [Bacillus subtilis strain ZD01]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1