Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   E3306_RS05200 Genome accession   NZ_CP038183
Coordinates   1075822..1076292 (+) Length   156 a.a.
NCBI ID   WP_029549393.1    Uniprot ID   -
Organism   Staphylococcus aureus strain MJ015     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1065757..1107871 1075822..1076292 within 0


Gene organization within MGE regions


Location: 1065757..1107871
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  E3306_RS05125 (E3306_05360) - 1065757..1067142 (-) 1386 WP_000861313.1 recombinase family protein -
  E3306_RS05130 (E3306_05365) - 1067200..1068129 (-) 930 WP_001253415.1 DUF5067 domain-containing protein -
  E3306_RS05135 (E3306_05370) - 1068147..1068608 (-) 462 WP_000525004.1 hypothetical protein -
  E3306_RS05140 (E3306_05375) - 1068621..1068935 (-) 315 WP_000333630.1 helix-turn-helix domain-containing protein -
  E3306_RS05145 (E3306_05380) - 1069087..1069323 (+) 237 WP_001121027.1 helix-turn-helix transcriptional regulator -
  E3306_RS05150 (E3306_05385) - 1069337..1070113 (+) 777 WP_031783556.1 Rha family transcriptional regulator -
  E3306_RS05155 - 1070142..1070309 (+) 168 WP_162852001.1 hypothetical protein -
  E3306_RS05160 (E3306_05390) - 1070360..1070842 (-) 483 WP_033858402.1 hypothetical protein -
  E3306_RS05165 (E3306_05395) - 1071052..1071282 (-) 231 WP_000395457.1 hypothetical protein -
  E3306_RS14145 - 1071341..1071469 (+) 129 WP_001559112.1 hypothetical protein -
  E3306_RS05170 (E3306_05400) - 1071462..1071623 (+) 162 WP_000066026.1 DUF1270 family protein -
  E3306_RS05175 (E3306_05405) - 1071717..1071977 (+) 261 WP_064127680.1 DUF1108 family protein -
  E3306_RS05180 (E3306_05410) - 1071986..1072249 (+) 264 WP_001205732.1 hypothetical protein -
  E3306_RS05185 (E3306_05415) - 1072258..1074201 (+) 1944 WP_168367621.1 AAA family ATPase -
  E3306_RS05190 (E3306_05420) - 1074203..1075123 (+) 921 WP_000138475.1 recombinase RecT -
  E3306_RS05195 (E3306_05425) - 1075204..1075821 (+) 618 WP_072528355.1 MBL fold metallo-hydrolase -
  E3306_RS05200 (E3306_05430) ssbA 1075822..1076292 (+) 471 WP_029549393.1 single-stranded DNA-binding protein Machinery gene
  E3306_RS05205 (E3306_05435) - 1076322..1077206 (+) 885 WP_031833239.1 DnaD domain protein -
  E3306_RS05210 (E3306_05440) - 1077213..1077431 (+) 219 WP_000338530.1 hypothetical protein -
  E3306_RS05215 (E3306_05445) - 1077440..1077844 (+) 405 WP_000401972.1 RusA family crossover junction endodeoxyribonuclease -
  E3306_RS05220 (E3306_05450) - 1077857..1078225 (+) 369 WP_076692367.1 SA1788 family PVL leukocidin-associated protein -
  E3306_RS05225 (E3306_05455) - 1078229..1078471 (+) 243 WP_000131382.1 SAV1978 family virulence-associated passenger protein -
  E3306_RS05230 (E3306_05460) - 1078486..1078770 (+) 285 WP_173950593.1 hypothetical protein -
  E3306_RS05235 (E3306_05465) - 1078763..1079011 (+) 249 WP_001065083.1 DUF1024 family protein -
  E3306_RS05240 (E3306_05470) - 1079004..1079534 (+) 531 WP_000185666.1 dUTPase -
  E3306_RS05245 (E3306_05475) - 1079571..1079816 (+) 246 WP_001282074.1 hypothetical protein -
  E3306_RS05250 (E3306_05480) - 1079813..1080019 (+) 207 WP_000195803.1 DUF1381 domain-containing protein -
  E3306_RS05255 (E3306_05485) - 1080016..1080402 (+) 387 WP_031807105.1 phage protein -
  E3306_RS05260 (E3306_05490) - 1080399..1080572 (+) 174 WP_000595302.1 transcriptional activator RinB -
  E3306_RS05265 (E3306_05495) - 1080573..1080974 (+) 402 WP_000286968.1 hypothetical protein -
  E3306_RS05270 (E3306_05505) - 1081320..1081808 (+) 489 WP_031904528.1 terminase small subunit -
  E3306_RS05275 (E3306_05510) - 1081792..1083057 (+) 1266 WP_108943820.1 PBSX family phage terminase large subunit -
  E3306_RS05280 (E3306_05515) - 1083076..1084482 (+) 1407 WP_031886702.1 phage portal protein -
  E3306_RS05285 (E3306_05520) - 1084421..1085401 (+) 981 WP_049949321.1 phage head morphogenesis protein -
  E3306_RS05290 (E3306_05525) - 1085499..1086095 (+) 597 WP_015967248.1 phage scaffolding protein -
  E3306_RS05295 (E3306_05530) - 1086116..1086940 (+) 825 WP_023180143.1 N4-gp56 family major capsid protein -
  E3306_RS05300 (E3306_05535) - 1086957..1087283 (+) 327 WP_173950594.1 Rho termination factor N-terminal domain-containing protein -
  E3306_RS05305 (E3306_05540) - 1087283..1087597 (+) 315 WP_000338934.1 phage head-tail connector protein -
  E3306_RS05310 (E3306_05545) - 1087590..1087925 (+) 336 WP_000482988.1 phage head closure protein -
  E3306_RS05315 (E3306_05550) - 1087912..1088325 (+) 414 WP_173950595.1 HK97-gp10 family putative phage morphogenesis protein -
  E3306_RS05320 (E3306_05555) - 1088338..1088775 (+) 438 WP_000270196.1 DUF3168 domain-containing protein -
  E3306_RS05325 (E3306_05560) - 1088762..1089322 (+) 561 WP_000046067.1 hypothetical protein -
  E3306_RS05330 (E3306_05565) - 1089384..1089878 (+) 495 WP_000141084.1 tail assembly chaperone -
  E3306_RS05335 (E3306_05570) - 1089899..1090240 (+) 342 WP_000204079.1 hypothetical protein -
  E3306_RS05340 (E3306_05575) - 1090300..1093386 (+) 3087 WP_234100648.1 terminase -
  E3306_RS05345 (E3306_05580) - 1093401..1094336 (+) 936 WP_000560198.1 phage tail domain-containing protein -
  E3306_RS05350 (E3306_05585) - 1094347..1096233 (+) 1887 WP_113613160.1 SGNH/GDSL hydrolase family protein -
  E3306_RS05355 (E3306_05590) - 1096246..1098144 (+) 1899 WP_072464659.1 hypothetical protein -
  E3306_RS05360 (E3306_05595) - 1098144..1099967 (+) 1824 WP_113613161.1 phage baseplate upper protein -
  E3306_RS05365 (E3306_05600) - 1099967..1100344 (+) 378 WP_000705909.1 DUF2977 domain-containing protein -
  E3306_RS05370 (E3306_05605) - 1100348..1100521 (+) 174 WP_001790193.1 XkdX family protein -
  E3306_RS05375 (E3306_05610) - 1100562..1100861 (+) 300 WP_000466769.1 DUF2951 domain-containing protein -
  E3306_RS05380 (E3306_05615) - 1100998..1102872 (+) 1875 WP_029265300.1 glucosaminidase domain-containing protein -
  E3306_RS05385 (E3306_05620) - 1102885..1104123 (+) 1239 WP_064282041.1 BppU family phage baseplate upper protein -
  E3306_RS05390 (E3306_05625) - 1104128..1104523 (+) 396 WP_000398878.1 hypothetical protein -
  E3306_RS05395 (E3306_05630) - 1104579..1105016 (+) 438 WP_001556691.1 phage holin -
  E3306_RS05400 (E3306_05635) - 1104997..1106442 (+) 1446 WP_173950597.1 SH3 domain-containing protein -
  E3306_RS05405 (E3306_05640) - 1106832..1107419 (+) 588 WP_000448197.1 hypothetical protein -
  E3306_RS05410 (E3306_05645) - 1107416..1107871 (+) 456 WP_000971220.1 hypothetical protein -

Sequence


Protein


Download         Length: 156 a.a.        Molecular weight: 17654.38 Da        Isoelectric Point: 4.6228

>NTDB_id=352163 E3306_RS05200 WP_029549393.1 1075822..1076292(+) (ssbA) [Staphylococcus aureus strain MJ015]
MLNRVVLVGRLTKDPEYRTTPSGVSVATFTLAVNRTFTNAQGEREADFVNCVVFRRQADNVNNYLSKGSLAGVDGRLQSR
NYENQEGRRVFVTEVVCDSVQFLEPKNTNDSQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANDPIEIDDDDLPF

Nucleotide


Download         Length: 471 bp        

>NTDB_id=352163 E3306_RS05200 WP_029549393.1 1075822..1076292(+) (ssbA) [Staphylococcus aureus strain MJ015]
ATGCTAAATAGAGTTGTATTAGTAGGTCGTTTAACGAAAGATCCGGAATACAGAACCACTCCTTCAGGTGTGAGTGTAGC
GACATTCACTCTTGCAGTAAATCGTACGTTCACGAATGCTCAAGGGGAGCGCGAAGCAGATTTTGTTAACTGTGTTGTTT
TTAGAAGACAAGCAGATAATGTAAATAACTATTTATCTAAAGGTAGTTTAGCTGGTGTAGATGGTCGCTTACAATCCCGT
AATTATGAAAATCAAGAAGGTCGTCGTGTGTTTGTTACTGAAGTTGTGTGTGATAGCGTTCAATTTTTAGAACCAAAGAA
CACAAATGACTCTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTCGCAAATGCGAATGATCCTATTGAAATAGATGACGATGATTTACCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

61.017

100

0.692

  ssb Latilactobacillus sakei subsp. sakei 23K

52.353

100

0.571

  ssbB Bacillus subtilis subsp. subtilis str. 168

59.434

67.949

0.404

  ssb Glaesserella parasuis strain SC1401

32.768

100

0.372


Multiple sequence alignment