Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   GL183_RS08705 Genome accession   NZ_CP046355
Coordinates   1690631..1690780 (-) Length   49 a.a.
NCBI ID   WP_001809846.1    Uniprot ID   Q00MV6
Organism   Streptococcus pneumoniae strain 475     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context

Location: 1685631..1695780
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GL183_RS08670 (GL183_08730) - 1685824..1686618 (-) 795 WP_000363002.1 phosphotransferase family protein -
  GL183_RS08675 (GL183_08735) - 1686779..1687390 (-) 612 WP_000394044.1 type II CAAX endopeptidase family protein -
  GL183_RS08680 (GL183_08740) blpZ 1687541..1687774 (-) 234 WP_000276498.1 immunity protein BlpZ -
  GL183_RS08685 (GL183_08745) - 1687816..1688505 (-) 690 WP_000760532.1 CPBP family intramembrane glutamic endopeptidase -
  GL183_RS08690 (GL183_08750) - 1688557..1688940 (-) 384 WP_000877381.1 hypothetical protein -
  GL183_RS08695 (GL183_08755) - 1689569..1689888 (-) 320 Protein_1687 immunity protein -
  GL183_RS08700 (GL183_08765) - 1690408..1690527 (-) 120 WP_000346296.1 PncF family bacteriocin immunity protein -
  GL183_RS08705 (GL183_08770) cipB 1690631..1690780 (-) 150 WP_001809846.1 bacteriocin-like peptide BlpO Regulator
  GL183_RS08710 (GL183_08775) blpK 1691024..1691272 (-) 249 WP_000379965.1 bacteriocin-like peptide BlpK -
  GL183_RS08715 (GL183_08780) blpJ 1691341..1691610 (-) 270 WP_001093248.1 bacteriocin-like peptide BlpJ -
  GL183_RS08720 (GL183_08785) blpI 1692077..1692274 (-) 198 WP_001093259.1 bacteriocin-like peptide BlpI -
  GL183_RS11910 comA/nlmT 1692556..1693143 (+) 588 WP_000205166.1 cysteine peptidase family C39 domain-containing protein Regulator
  GL183_RS08730 (GL183_08790) comA/nlmT 1693070..1694713 (+) 1644 WP_078133412.1 peptide cleavage/export ABC transporter Regulator

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5149.92 Da        Isoelectric Point: 4.0439

>NTDB_id=350797 GL183_RS08705 WP_001809846.1 1690631..1690780(-) (cipB) [Streptococcus pneumoniae strain 475]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=350797 GL183_RS08705 WP_001809846.1 1690631..1690780(-) (cipB) [Streptococcus pneumoniae strain 475]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterProScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-44)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB Q00MV6

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

53.061

100

0.531