Detailed information
Bioinformatically predicted
Overview
| Name | sxy/tfoX | Type | Regulator |
| Locus tag | EKN05_RS11510 | Genome accession | NZ_CP037923 |
| Coordinates | 2199764..2200015 (-) | Length | 83 a.a. |
| NCBI ID | WP_073705626.1 | Uniprot ID | A0A4P7TN66 |
| Organism | Shigella flexneri 5a str. M90T | ||
| Function | positive regulator of competence gene (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 2190592..2231124 | 2199764..2200015 | within | 0 |
| IScluster/Tn | 2200000..2201228 | 2199764..2200015 | flank | -15 |
Gene organization within MGE regions
Location: 2190592..2231124
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EKN05_RS11460 (EKN05_011475) | tusE | 2190863..2191192 (+) | 330 | WP_000904442.1 | sulfurtransferase TusE | - |
| EKN05_RS11465 (EKN05_011480) | yccX | 2191189..2191467 (-) | 279 | WP_000048219.1 | acylphosphatase | - |
| EKN05_RS11470 (EKN05_011485) | rlmI | 2191562..2192752 (+) | 1191 | WP_000116288.1 | 23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI | - |
| EKN05_RS11475 (EKN05_011490) | hspQ | 2192810..2193127 (+) | 318 | WP_001295356.1 | heat shock protein HspQ | - |
| EKN05_RS11480 (EKN05_011495) | - | 2193172..2193585 (-) | 414 | WP_000665217.1 | CoA-binding protein | - |
| EKN05_RS11485 (EKN05_011500) | - | 2193758..2194420 (+) | 663 | WP_000847779.1 | DUF2057 family protein | - |
| EKN05_RS11490 (EKN05_011505) | mgsA | 2194516..2194974 (+) | 459 | WP_000424181.1 | methylglyoxal synthase | - |
| EKN05_RS11495 (EKN05_011510) | helD | 2195006..2197060 (-) | 2055 | WP_024260251.1 | DNA helicase IV | - |
| EKN05_RS11500 (EKN05_011515) | - | 2197183..2197629 (+) | 447 | WP_001261235.1 | YccF domain-containing protein | - |
| EKN05_RS11505 (EKN05_011520) | yccS | 2197639..2199801 (+) | 2163 | WP_000875052.1 | YccS family putative transporter | - |
| EKN05_RS11510 (EKN05_011525) | sxy/tfoX | 2199764..2200015 (-) | 252 | WP_073705626.1 | TfoX/Sxy family protein | Regulator |
| EKN05_RS11520 (EKN05_011535) | sxy | 2201319..2201729 (-) | 411 | Protein_2226 | CRP-S regulon transcriptional coactivator Sxy | - |
| EKN05_RS11525 (EKN05_011540) | sulA | 2201948..2202457 (+) | 510 | WP_000288715.1 | SOS-induced cell division inhibitor SulA | - |
| EKN05_RS11530 (EKN05_011545) | ompA | 2202813..2203859 (+) | 1047 | WP_005105223.1 | porin OmpA | - |
| EKN05_RS11535 (EKN05_011550) | matP | 2203935..2204387 (-) | 453 | WP_000877161.1 | macrodomain Ter protein MatP | - |
| EKN05_RS11540 (EKN05_011555) | - | 2204572..2206332 (+) | 1761 | WP_000156491.1 | Lon protease family protein | - |
| EKN05_RS11545 (EKN05_011560) | fabA | 2206401..2206919 (+) | 519 | WP_005047466.1 | bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase | - |
| EKN05_RS11550 (EKN05_011565) | rmf | 2206989..2207156 (-) | 168 | WP_011110566.1 | ribosome modulation factor | - |
| EKN05_RS11555 (EKN05_011570) | pqiC | 2207412..2207975 (-) | 564 | WP_000759120.1 | membrane integrity-associated transporter subunit PqiC | - |
| EKN05_RS11560 (EKN05_011575) | pqiB | 2207972..2209612 (-) | 1641 | WP_000445541.1 | intermembrane transport protein PqiB | - |
| EKN05_RS11565 (EKN05_011580) | pqiA | 2209617..2210870 (-) | 1254 | WP_000333176.1 | membrane integrity-associated transporter subunit PqiA | - |
| EKN05_RS11570 (EKN05_011585) | - | 2211000..2212907 (-) | 1908 | WP_000053059.1 | ABC transporter ATP-binding protein | - |
| EKN05_RS11575 (EKN05_011590) | rlmKL | 2212919..2215027 (-) | 2109 | WP_001086554.1 | bifunctional 23S rRNA (guanine(2069)-N(7))-methyltransferase RlmK/23S rRNA (guanine(2445)-N(2))-methyltransferase RlmL | - |
| EKN05_RS11580 (EKN05_011595) | ycbX | 2215271..2216380 (+) | 1110 | WP_000224274.1 | 6-N-hydroxylaminopurine resistance protein YcbX | - |
| EKN05_RS11585 (EKN05_011600) | zapC | 2216377..2216919 (-) | 543 | WP_004991542.1 | cell division protein ZapC | - |
| EKN05_RS11590 (EKN05_011605) | pyrD | 2217093..2218103 (-) | 1011 | WP_001370288.1 | quinone-dependent dihydroorotate dehydrogenase | - |
| EKN05_RS11595 (EKN05_011610) | - | 2218214..2218950 (-) | 737 | Protein_2241 | fimbrial chaperone | - |
| EKN05_RS11600 (EKN05_011615) | - | 2218916..2219431 (-) | 516 | WP_000919489.1 | fimbrial protein | - |
| EKN05_RS11605 (EKN05_011620) | - | 2219439..2219981 (-) | 543 | WP_000730630.1 | fimbrial protein | - |
| EKN05_RS11610 (EKN05_011625) | - | 2219993..2221062 (-) | 1070 | Protein_2244 | fimbrial protein | - |
| EKN05_RS11615 (EKN05_011630) | - | 2221053..2223653 (-) | 2601 | WP_000286330.1 | fimbrial biogenesis usher protein | - |
| EKN05_RS11620 (EKN05_011635) | - | 2223678..2224379 (-) | 702 | WP_005105220.1 | molecular chaperone | - |
| EKN05_RS11625 (EKN05_011640) | - | 2224462..2224560 (-) | 99 | Protein_2247 | fimbrial protein | - |
| EKN05_RS11630 (EKN05_011645) | - | 2224629..2225326 (+) | 698 | Protein_2248 | IS1 family transposase | - |
| EKN05_RS11635 (EKN05_011650) | - | 2225624..2226085 (+) | 462 | WP_000750297.1 | fimbrial protein | - |
| EKN05_RS11645 (EKN05_011660) | ssuE | 2226914..2227489 (+) | 576 | WP_001263929.1 | NADPH-dependent FMN reductase | - |
| EKN05_RS11650 (EKN05_011665) | ssuA | 2227482..2228441 (+) | 960 | WP_001244322.1 | aliphatic sulfonate ABC transporter substrate-binding protein SsuA | - |
| EKN05_RS11655 (EKN05_011670) | ssuD | 2228438..2229583 (+) | 1146 | WP_000056001.1 | FMNH2-dependent alkanesulfonate monooxygenase | - |
| EKN05_RS11660 (EKN05_011675) | - | 2229595..2229774 (+) | 180 | Protein_2254 | hypothetical protein | - |
| EKN05_RS11665 (EKN05_011680) | - | 2229866..2231094 (+) | 1229 | WP_094081542.1 | IS3-like element IS2 family transposase | - |
Sequence
Protein
Download Length: 83 a.a. Molecular weight: 9234.86 Da Isoelectric Point: 6.9794
>NTDB_id=350638 EKN05_RS11510 WP_073705626.1 2199764..2200015(-) (sxy/tfoX) [Shigella flexneri 5a str. M90T]
MPGNIGANPVGIKDVRALRILGAKMCWLRLRQQNSLVTEKILFMLEGAIIGIHEAALPVARRQELAEWADSLTPKQEFPA
ELE
MPGNIGANPVGIKDVRALRILGAKMCWLRLRQQNSLVTEKILFMLEGAIIGIHEAALPVARRQELAEWADSLTPKQEFPA
ELE
Nucleotide
Download Length: 252 bp
>NTDB_id=350638 EKN05_RS11510 WP_073705626.1 2199764..2200015(-) (sxy/tfoX) [Shigella flexneri 5a str. M90T]
ATGCCTGGAAATATAGGGGCAAATCCAGTGGGGATTAAGGATGTACGGGCGTTACGTATACTTGGGGCAAAAATGTGTTG
GTTGCGACTGCGGCAGCAAAACAGTCTGGTGACAGAAAAGATTCTGTTTATGCTTGAAGGTGCCATTATCGGCATTCATG
AAGCTGCGCTCCCGGTGGCACGCCGCCAGGAGCTTGCAGAATGGGCTGACTCTCTTACGCCGAAACAGGAGTTTCCTGCG
GAGCTTGAGTAA
ATGCCTGGAAATATAGGGGCAAATCCAGTGGGGATTAAGGATGTACGGGCGTTACGTATACTTGGGGCAAAAATGTGTTG
GTTGCGACTGCGGCAGCAAAACAGTCTGGTGACAGAAAAGATTCTGTTTATGCTTGAAGGTGCCATTATCGGCATTCATG
AAGCTGCGCTCCCGGTGGCACGCCGCCAGGAGCTTGCAGAATGGGCTGACTCTCTTACGCCGAAACAGGAGTTTCCTGCG
GAGCTTGAGTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sxy/tfoX | Escherichia coli BW25113 strain K-12 |
100 |
89.157 |
0.892 |