Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   MGAS15252_RS00600 Genome accession   NC_017040
Coordinates   98470..98754 (+) Length   94 a.a.
NCBI ID   WP_002987779.1    Uniprot ID   A0A0H2USY2
Organism   Streptococcus pyogenes MGAS15252     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 93470..103754
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MGAS15252_RS00575 (MGAS15252_0119) - 95430..95795 (+) 366 WP_002986560.1 DUF1033 family protein -
  MGAS15252_RS00580 (MGAS15252_0120) comGA 95888..96812 (+) 925 Protein_81 competence type IV pilus ATPase ComGA -
  MGAS15252_RS00585 (MGAS15252_0121) comGB 96748..97782 (+) 1035 WP_227868709.1 competence type IV pilus assembly protein ComGB Machinery gene
  MGAS15252_RS00590 (MGAS15252_0122) comGC 97784..98110 (+) 327 WP_014407214.1 competence type IV pilus major pilin ComGC Machinery gene
  MGAS15252_RS00595 (MGAS15252_0123) comGD 98085..98513 (+) 429 WP_002986548.1 competence type IV pilus minor pilin ComGD Machinery gene
  MGAS15252_RS00600 (MGAS15252_0124) comGE 98470..98754 (+) 285 WP_002987779.1 competence type IV pilus minor pilin ComGE Machinery gene
  MGAS15252_RS00605 (MGAS15252_0125) comGF 98747..99181 (+) 435 WP_014407215.1 competence type IV pilus minor pilin ComGF Machinery gene
  MGAS15252_RS00610 (MGAS15252_0126) comGG 99165..99491 (+) 327 WP_010921801.1 competence type IV pilus minor pilin ComGG -
  MGAS15252_RS00615 (MGAS15252_0127) comGH 99589..100542 (+) 954 WP_014407216.1 class I SAM-dependent methyltransferase Machinery gene
  MGAS15252_RS00620 (MGAS15252_0128) - 100601..101797 (+) 1197 WP_014407217.1 acetate kinase -
  MGAS15252_RS00625 (MGAS15252_0129) - 101984..102292 (+) 309 WP_041174321.1 hypothetical protein -
  MGAS15252_RS00630 (MGAS15252_0130) proC 102375..103145 (-) 771 WP_014407219.1 pyrroline-5-carboxylate reductase -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10672.62 Da        Isoelectric Point: 8.9043

>NTDB_id=35017 MGAS15252_RS00600 WP_002987779.1 98470..98754(+) (comGE) [Streptococcus pyogenes MGAS15252]
MGIIKKQVKAYIALESMIATGILFSIVILVLSSLQQSQAALTYYRKQQEKLNLALMAVQTRTKEMTLNGCHITILRTDRY
ISIHDDEGEVMKIE

Nucleotide


Download         Length: 285 bp        

>NTDB_id=35017 MGAS15252_RS00600 WP_002987779.1 98470..98754(+) (comGE) [Streptococcus pyogenes MGAS15252]
GTGGGAATTATCAAAAAACAAGTCAAAGCTTACATAGCCCTTGAAAGTATGATCGCAACAGGCATCCTCTTTAGTATTGT
CATTCTCGTCTTAAGCAGTTTACAGCAGAGTCAGGCTGCTCTAACGTACTATCGAAAGCAGCAAGAAAAGCTTAATCTAG
CCTTGATGGCAGTACAAACTAGAACTAAAGAGATGACATTAAATGGTTGTCATATTACTATTTTACGTACGGATAGATAC
ATTAGTATTCACGATGACGAAGGAGAAGTGATGAAGATTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A0H2USY2

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Lactococcus lactis subsp. cremoris KW2

38.298

100

0.383


Multiple sequence alignment