Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | EYB46_RS15145 | Genome accession | NZ_CP036518 |
| Coordinates | 3063004..3063144 (+) | Length | 46 a.a. |
| NCBI ID | WP_003152043.1 | Uniprot ID | A3KLB4 |
| Organism | Bacillus velezensis strain ANSB01E | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3058004..3068144
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EYB46_RS15115 (EYB46_15110) | - | 3058307..3058705 (+) | 399 | WP_003152031.1 | DUF1694 domain-containing protein | - |
| EYB46_RS15120 (EYB46_15115) | - | 3058802..3059353 (+) | 552 | WP_003152033.1 | isochorismatase family cysteine hydrolase | - |
| EYB46_RS15125 (EYB46_15120) | - | 3059371..3060837 (+) | 1467 | WP_014418767.1 | nicotinate phosphoribosyltransferase | - |
| EYB46_RS15130 (EYB46_15125) | - | 3060967..3062190 (+) | 1224 | WP_032876792.1 | EAL and HDOD domain-containing protein | - |
| EYB46_RS15135 (EYB46_15130) | - | 3062197..3062538 (-) | 342 | WP_032876795.1 | hypothetical protein | - |
| EYB46_RS15145 (EYB46_15140) | degQ | 3063004..3063144 (+) | 141 | WP_003152043.1 | degradation enzyme regulation protein DegQ | Regulator |
| EYB46_RS15150 (EYB46_15145) | - | 3063352..3064212 (+) | 861 | WP_142925231.1 | polyprenyl synthetase family protein | - |
| EYB46_RS15155 (EYB46_15150) | comX | 3064181..3064354 (+) | 174 | WP_012118314.1 | competence pheromone ComX | - |
| EYB46_RS15160 (EYB46_15155) | comP | 3064368..3066668 (+) | 2301 | WP_032876801.1 | histidine kinase | Regulator |
| EYB46_RS15165 (EYB46_15160) | comA | 3066749..3067393 (+) | 645 | WP_003152052.1 | response regulator transcription factor | Regulator |
| EYB46_RS15170 (EYB46_15165) | - | 3067415..3067798 (+) | 384 | WP_007613430.1 | hotdog fold thioesterase | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5518.30 Da Isoelectric Point: 4.9432
>NTDB_id=349324 EYB46_RS15145 WP_003152043.1 3063004..3063144(+) (degQ) [Bacillus velezensis strain ANSB01E]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=349324 EYB46_RS15145 WP_003152043.1 3063004..3063144(+) (degQ) [Bacillus velezensis strain ANSB01E]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
89.13 |
100 |
0.891 |