Detailed information    

insolico Bioinformatically predicted

Overview


Name   comX   Type   Regulator
Locus tag   GII87_RS17170 Genome accession   NZ_CP045922
Coordinates   3255441..3255608 (-) Length   55 a.a.
NCBI ID   WP_003242801.1    Uniprot ID   A8D470
Organism   Bacillus subtilis strain P8_B1     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context


Location: 3250441..3260608
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GII87_RS17140 (GII87_17140) mrpE 3250836..3251312 (+) 477 WP_003244015.1 Na+/H+ antiporter subunit E -
  GII87_RS17145 (GII87_17145) mrpF 3251312..3251596 (+) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  GII87_RS17150 (GII87_17150) mnhG 3251580..3251954 (+) 375 WP_003244302.1 monovalent cation/H(+) antiporter subunit G -
  GII87_RS17155 (GII87_17155) yuxO 3251993..3252373 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  GII87_RS17160 (GII87_17160) comA 3252392..3253036 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  GII87_RS17165 (GII87_17165) comP 3253117..3255426 (-) 2310 WP_003242894.1 two-component system sensor histidine kinase ComP Regulator
  GII87_RS17170 (GII87_17170) comX 3255441..3255608 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  GII87_RS17175 (GII87_17175) comQ 3255596..3256495 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  GII87_RS17180 (GII87_17180) degQ 3256680..3256820 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  GII87_RS17185 (GII87_17185) - 3257042..3257167 (+) 126 WP_003228793.1 hypothetical protein -
  GII87_RS17190 (GII87_17190) - 3257281..3257649 (+) 369 WP_003243784.1 hypothetical protein -
  GII87_RS17195 (GII87_17195) pdeH 3257625..3258854 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  GII87_RS17200 (GII87_17200) pncB 3258991..3260463 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -

Sequence


Protein


Download         Length: 55 a.a.        Molecular weight: 6518.42 Da        Isoelectric Point: 4.3285

>NTDB_id=348657 GII87_RS17170 WP_003242801.1 3255441..3255608(-) (comX) [Bacillus subtilis strain P8_B1]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD

Nucleotide


Download         Length: 168 bp        

>NTDB_id=348657 GII87_RS17170 WP_003242801.1 3255441..3255608(-) (comX) [Bacillus subtilis strain P8_B1]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATCTGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A8D470

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment