Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   GII78_RS13275 Genome accession   NZ_CP045824
Coordinates   2549691..2549864 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0ABU0V3E4
Organism   Bacillus subtilis strain MB8_B10     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2544691..2554864
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GII78_RS13260 (GII78_13260) gcvT 2545491..2546579 (-) 1089 WP_015714248.1 glycine cleavage system aminomethyltransferase GcvT -
  GII78_RS13265 (GII78_13265) hepAA 2547020..2548693 (+) 1674 WP_029726726.1 SNF2-related protein -
  GII78_RS13270 (GII78_13270) yqhG 2548714..2549508 (+) 795 WP_015714249.1 YqhG family protein -
  GII78_RS13275 (GII78_13275) sinI 2549691..2549864 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  GII78_RS13280 (GII78_13280) sinR 2549898..2550233 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  GII78_RS13285 (GII78_13285) tasA 2550326..2551111 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  GII78_RS13290 (GII78_13290) sipW 2551175..2551747 (-) 573 WP_072692741.1 signal peptidase I SipW -
  GII78_RS13295 (GII78_13295) tapA 2551731..2552492 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  GII78_RS13300 (GII78_13300) yqzG 2552764..2553090 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  GII78_RS13305 (GII78_13305) spoIITA 2553132..2553311 (-) 180 WP_029726723.1 YqzE family protein -
  GII78_RS13310 (GII78_13310) comGG 2553383..2553757 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  GII78_RS13315 (GII78_13315) comGF 2553758..2554141 (-) 384 WP_029726721.1 ComG operon protein ComGF Machinery gene
  GII78_RS13320 (GII78_13320) comGE 2554167..2554514 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=347735 GII78_RS13275 WP_003230187.1 2549691..2549864(+) (sinI) [Bacillus subtilis strain MB8_B10]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=347735 GII78_RS13275 WP_003230187.1 2549691..2549864(+) (sinI) [Bacillus subtilis strain MB8_B10]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1