Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   GII82_RS16270 Genome accession   NZ_CP045819
Coordinates   3143780..3143920 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain MB9_B4     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3138780..3148920
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GII82_RS16245 (GII82_16245) yuxO 3139093..3139473 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  GII82_RS16250 (GII82_16250) comA 3139492..3140136 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  GII82_RS16255 (GII82_16255) comP 3140217..3142526 (-) 2310 WP_015251333.1 two-component system sensor histidine kinase ComP Regulator
  GII82_RS16260 (GII82_16260) comX 3142541..3142708 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  GII82_RS16265 (GII82_16265) comQ 3142696..3143595 (-) 900 WP_015251332.1 ComX modifying isoprenyl transferase ComQ Regulator
  GII82_RS16270 (GII82_16270) degQ 3143780..3143920 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  GII82_RS16275 (GII82_16275) - 3144142..3144267 (+) 126 WP_003228793.1 hypothetical protein -
  GII82_RS16280 (GII82_16280) - 3144381..3144749 (+) 369 WP_014477834.1 hypothetical protein -
  GII82_RS16285 (GII82_16285) pdeH 3144725..3145954 (-) 1230 WP_024572553.1 cyclic di-GMP phosphodiesterase -
  GII82_RS16290 (GII82_16290) pncB 3146091..3147563 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  GII82_RS16295 (GII82_16295) pncA 3147579..3148130 (-) 552 WP_014477836.1 isochorismatase family cysteine hydrolase -
  GII82_RS16300 (GII82_16300) yueI 3148227..3148625 (-) 399 WP_015251331.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=347155 GII82_RS16270 WP_003220708.1 3143780..3143920(-) (degQ) [Bacillus subtilis strain MB9_B4]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=347155 GII82_RS16270 WP_003220708.1 3143780..3143920(-) (degQ) [Bacillus subtilis strain MB9_B4]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1