Detailed information    

insolico Bioinformatically predicted

Overview

Name   abrB   Type   Regulator
Locus tag   EXW55_RS28125 Genome accession   NZ_CP036121
Coordinates   5463408..5463686 (+) Length   92 a.a.
NCBI ID   WP_215596134.1    Uniprot ID   -
Organism   Bacillus mycoides strain JAS635     
Function   repression of comK; repression of rok (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 5451673..5473380 5463408..5463686 within 0


Gene organization within MGE regions


Location: 5451673..5473380
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EXW55_RS28035 (EXW55_28545) - 5451673..5452797 (-) 1125 WP_098146395.1 tyrosine-type recombinase/integrase -
  EXW55_RS28040 (EXW55_28550) - 5453312..5453581 (-) 270 WP_098110900.1 hypothetical protein -
  EXW55_RS28045 - 5453890..5454051 (+) 162 WP_215560145.1 hypothetical protein -
  EXW55_RS28055 (EXW55_28560) - 5454609..5455256 (-) 648 WP_215560146.1 class D sortase -
  EXW55_RS28060 (EXW55_28565) - 5455316..5455870 (-) 555 WP_215560147.1 excalibur calcium-binding domain-containing protein -
  EXW55_RS28065 (EXW55_28570) - 5456432..5456776 (-) 345 WP_016097570.1 helix-turn-helix transcriptional regulator -
  EXW55_RS28070 (EXW55_28575) - 5457370..5458542 (+) 1173 WP_215560148.1 AimR family lysis-lysogeny pheromone receptor -
  EXW55_RS28075 - 5458539..5458694 (+) 156 WP_215560149.1 hypothetical protein -
  EXW55_RS32280 - 5458858..5458989 (+) 132 WP_286675888.1 hypothetical protein -
  EXW55_RS28080 (EXW55_28580) - 5459008..5459343 (-) 336 WP_215560150.1 helix-turn-helix transcriptional regulator -
  EXW55_RS28085 (EXW55_28585) - 5459607..5459810 (+) 204 WP_215560151.1 helix-turn-helix transcriptional regulator -
  EXW55_RS28090 (EXW55_28590) - 5459892..5460683 (+) 792 WP_215560152.1 phage antirepressor KilAC domain-containing protein -
  EXW55_RS28095 (EXW55_28595) - 5460748..5461098 (+) 351 WP_215572332.1 helix-turn-helix domain-containing protein -
  EXW55_RS28100 - 5461095..5461262 (+) 168 WP_215596209.1 hypothetical protein -
  EXW55_RS28105 (EXW55_28600) - 5461292..5461474 (+) 183 WP_215596210.1 hypothetical protein -
  EXW55_RS28110 (EXW55_28605) - 5461481..5462368 (+) 888 WP_215596132.1 DnaD domain protein -
  EXW55_RS28115 (EXW55_28610) - 5462319..5463182 (+) 864 WP_215596208.1 ATP-binding protein -
  EXW55_RS28120 (EXW55_28615) - 5463198..5463392 (+) 195 WP_215596133.1 hypothetical protein -
  EXW55_RS28125 (EXW55_28620) abrB 5463408..5463686 (+) 279 WP_215596134.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Regulator
  EXW55_RS28130 (EXW55_28625) - 5463679..5464038 (+) 360 WP_215596135.1 cell division protein SepF -
  EXW55_RS28135 (EXW55_28630) - 5464057..5464224 (+) 168 WP_078214143.1 DUF3954 domain-containing protein -
  EXW55_RS28140 (EXW55_28635) - 5464250..5464501 (+) 252 WP_078205964.1 helix-turn-helix domain containing protein -
  EXW55_RS28145 (EXW55_28640) - 5464519..5464974 (+) 456 WP_215596136.1 nucleoside triphosphate pyrophosphohydrolase family protein -
  EXW55_RS28150 (EXW55_28645) - 5465014..5465364 (+) 351 WP_215596137.1 hypothetical protein -
  EXW55_RS28155 (EXW55_28650) - 5465400..5465714 (+) 315 WP_215596138.1 hypothetical protein -
  EXW55_RS28160 (EXW55_28655) - 5465750..5466208 (+) 459 WP_215560164.1 hypothetical protein -
  EXW55_RS28165 - 5466231..5466404 (+) 174 WP_176520646.1 hypothetical protein -
  EXW55_RS28170 (EXW55_28660) - 5466401..5466703 (+) 303 WP_215596139.1 hypothetical protein -
  EXW55_RS28175 - 5466741..5466911 (+) 171 WP_215596140.1 hypothetical protein -
  EXW55_RS28180 (EXW55_28665) - 5467242..5467562 (+) 321 WP_215596141.1 hypothetical protein -
  EXW55_RS28185 (EXW55_28670) - 5467600..5467866 (+) 267 WP_215596142.1 hypothetical protein -
  EXW55_RS28190 - 5468092..5468265 (+) 174 WP_215596143.1 hypothetical protein -
  EXW55_RS28195 - 5468295..5468468 (+) 174 WP_016095515.1 hypothetical protein -
  EXW55_RS28200 (EXW55_28675) - 5468487..5468564 (+) 78 Protein_5537 DUF3983 domain-containing protein -
  EXW55_RS28205 - 5468676..5468846 (+) 171 WP_048376391.1 hypothetical protein -
  EXW55_RS28210 (EXW55_28680) - 5468874..5469356 (+) 483 WP_078204473.1 ArpU family phage packaging/lysis transcriptional regulator -
  EXW55_RS28215 (EXW55_28685) - 5469356..5469898 (+) 543 WP_002010102.1 site-specific integrase -
  EXW55_RS28220 (EXW55_28690) - 5470162..5470356 (+) 195 WP_215596145.1 hypothetical protein -
  EXW55_RS28225 (EXW55_28695) - 5470360..5470923 (+) 564 WP_215596146.1 GNAT family N-acetyltransferase -
  EXW55_RS28230 - 5471356..5471526 (+) 171 WP_215596147.1 hypothetical protein -
  EXW55_RS28235 (EXW55_28705) - 5471526..5471798 (+) 273 WP_215596148.1 hypothetical protein -
  EXW55_RS28240 (EXW55_28710) - 5471785..5471997 (+) 213 WP_215596149.1 hypothetical protein -
  EXW55_RS28245 (EXW55_28715) - 5472126..5472380 (+) 255 WP_215596150.1 hypothetical protein -
  EXW55_RS28250 (EXW55_28720) - 5472370..5472768 (+) 399 WP_215596151.1 HNH endonuclease -
  EXW55_RS28255 (EXW55_28725) - 5472877..5473380 (+) 504 WP_061675010.1 phage terminase small subunit P27 family -

Sequence

Protein


Download         Length: 92 a.a.        Molecular weight: 10082.56 Da        Isoelectric Point: 5.6398

>NTDB_id=347005 EXW55_RS28125 WP_215596134.1 5463408..5463686(+) (abrB) [Bacillus mycoides strain JAS635]
MKNTGVARKVDELGRVVIPVELRRTLGIAEGTTLDFHVDGENIVLRKHEKSCFVTGEVSESNLELLGGRMYLSKDGASEL
LDLLEKSGMTHA

Nucleotide


Download         Length: 279 bp        

>NTDB_id=347005 EXW55_RS28125 WP_215596134.1 5463408..5463686(+) (abrB) [Bacillus mycoides strain JAS635]
GTGAAAAACACAGGTGTTGCAAGAAAAGTGGACGAGCTAGGGCGTGTAGTAATTCCGGTTGAGTTACGCAGAACTTTGGG
GATTGCTGAAGGAACAACATTAGACTTTCATGTTGATGGGGAAAACATCGTTTTAAGAAAACATGAAAAGTCATGTTTTG
TAACAGGTGAAGTATCTGAATCCAACTTGGAATTATTGGGCGGCCGGATGTATTTGAGTAAGGATGGGGCAAGTGAGTTA
CTGGATCTTCTTGAGAAGAGTGGGATGACACATGCCTAA

Domains

Predicted by InterproScan.

AbrB C-terminal domain (AbrB_C)

(52-86)

Antidote-toxin recognition MazE, bacterial antitoxin (MazE_antitoxin)

(8-49)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  abrB Bacillus subtilis subsp. subtilis str. 168

60.241

90.217

0.543

Multiple sequence alignment