Detailed information    

insolico Bioinformatically predicted

Overview

Name   abrB   Type   Regulator
Locus tag   EXW59_RS24530 Genome accession   NZ_CP036084
Coordinates   3927356..3927634 (-) Length   92 a.a.
NCBI ID   WP_215559970.1    Uniprot ID   -
Organism   Bacillus mycoides strain JAS1004     
Function   repression of comK; repression of rok (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 3890646..3928034 3927356..3927634 within 0


Gene organization within MGE regions


Location: 3890646..3928034
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EXW59_RS24280 (EXW59_24835) panE 3891563..3892450 (-) 888 WP_033709393.1 2-dehydropantoate 2-reductase -
  EXW59_RS24285 (EXW59_24840) - 3892746..3893219 (+) 474 WP_002014751.1 N-acetyltransferase -
  EXW59_RS24290 (EXW59_24845) - 3893253..3893759 (-) 507 WP_002033739.1 RsfA family transcriptional regulator -
  EXW59_RS24295 (EXW59_24850) rpmF 3893889..3894062 (-) 174 WP_001984764.1 50S ribosomal protein L32 -
  EXW59_RS24300 (EXW59_24855) - 3894124..3894624 (-) 501 WP_002014753.1 DUF177 domain-containing protein -
  EXW59_RS24305 (EXW59_24865) - 3894908..3895525 (-) 618 WP_215559938.1 replication-relaxation family protein -
  EXW59_RS24310 (EXW59_24870) - 3895467..3896648 (-) 1182 WP_215559939.1 FtsK/SpoIIIE domain-containing protein -
  EXW59_RS24315 (EXW59_24875) - 3896766..3896948 (-) 183 WP_215559940.1 hypothetical protein -
  EXW59_RS24320 (EXW59_24880) - 3896951..3897253 (-) 303 WP_078204496.1 hypothetical protein -
  EXW59_RS24325 (EXW59_24885) - 3897407..3897610 (+) 204 WP_128853643.1 helix-turn-helix transcriptional regulator -
  EXW59_RS24330 (EXW59_24890) - 3897687..3898016 (+) 330 WP_078204494.1 TFIIB-type zinc ribbon-containing protein -
  EXW59_RS24335 (EXW59_24895) - 3898060..3898788 (-) 729 WP_214932325.1 N-acetylmuramoyl-L-alanine amidase -
  EXW59_RS24340 (EXW59_24900) - 3898788..3899009 (-) 222 WP_215559941.1 lysine exporter LysO family protein -
  EXW59_RS24345 (EXW59_24905) - 3899012..3899292 (-) 281 Protein_3882 hypothetical protein -
  EXW59_RS24350 (EXW59_24910) - 3899365..3899589 (-) 225 WP_215559601.1 hemolysin XhlA family protein -
  EXW59_RS24355 (EXW59_24915) - 3899725..3903582 (-) 3858 WP_215559942.1 phage tail spike protein -
  EXW59_RS24360 (EXW59_24920) - 3903579..3905069 (-) 1491 WP_215559943.1 distal tail protein Dit -
  EXW59_RS24365 (EXW59_24925) - 3905084..3908929 (-) 3846 WP_215559944.1 phage tail tape measure protein -
  EXW59_RS24370 - 3908945..3909121 (-) 177 WP_157404892.1 hypothetical protein -
  EXW59_RS24375 (EXW59_24930) - 3909151..3909468 (-) 318 WP_215559945.1 hypothetical protein -
  EXW59_RS24380 (EXW59_24935) - 3909517..3910125 (-) 609 WP_078204485.1 major tail protein -
  EXW59_RS24385 (EXW59_24940) - 3910126..3910485 (-) 360 WP_088028624.1 DUF3168 domain-containing protein -
  EXW59_RS24390 (EXW59_24945) - 3910482..3910916 (-) 435 WP_215559946.1 HK97-gp10 family putative phage morphogenesis protein -
  EXW59_RS24395 (EXW59_24950) - 3910909..3911232 (-) 324 WP_215559947.1 phage head closure protein -
  EXW59_RS24400 (EXW59_24955) - 3911229..3911507 (-) 279 WP_215559948.1 head-tail connector protein -
  EXW59_RS24405 (EXW59_24960) - 3911528..3912700 (-) 1173 WP_215559949.1 phage major capsid protein -
  EXW59_RS24410 (EXW59_24965) - 3912738..3913448 (-) 711 WP_098649155.1 head maturation protease, ClpP-related -
  EXW59_RS24415 (EXW59_24970) - 3913435..3914682 (-) 1248 WP_215559950.1 phage portal protein -
  EXW59_RS24420 (EXW59_24975) - 3914871..3916565 (-) 1695 WP_215559951.1 terminase TerL endonuclease subunit -
  EXW59_RS24425 (EXW59_24980) - 3916562..3917071 (-) 510 WP_170968352.1 phage terminase small subunit P27 family -
  EXW59_RS24430 (EXW59_24985) - 3917200..3917577 (-) 378 WP_215559952.1 HNH endonuclease -
  EXW59_RS24435 (EXW59_24990) - 3917567..3917821 (-) 255 WP_215559953.1 hypothetical protein -
  EXW59_RS24440 (EXW59_24995) - 3917828..3918253 (-) 426 WP_215559954.1 hypothetical protein -
  EXW59_RS24445 (EXW59_25000) - 3918382..3918594 (-) 213 WP_215559955.1 hypothetical protein -
  EXW59_RS32965 - 3918581..3918703 (-) 123 WP_286675884.1 hypothetical protein -
  EXW59_RS24450 (EXW59_25005) - 3918727..3918981 (-) 255 WP_215559956.1 hypothetical protein -
  EXW59_RS24455 (EXW59_25010) - 3918974..3919174 (-) 201 WP_215559957.1 hypothetical protein -
  EXW59_RS24460 (EXW59_25015) - 3919581..3919931 (-) 351 WP_215559958.1 zinc-finger domain-containing protein -
  EXW59_RS24465 (EXW59_25020) - 3920067..3920495 (-) 429 WP_215559959.1 hypothetical protein -
  EXW59_RS24470 (EXW59_25025) - 3921028..3921570 (-) 543 WP_215559960.1 site-specific integrase -
  EXW59_RS24475 (EXW59_25030) - 3921570..3922052 (-) 483 WP_215559961.1 ArpU family phage packaging/lysis transcriptional regulator -
  EXW59_RS24480 (EXW59_25035) - 3922363..3922485 (-) 123 WP_002138060.1 DUF3983 domain-containing protein -
  EXW59_RS24485 (EXW59_25040) - 3922524..3922784 (-) 261 WP_215559962.1 hypothetical protein -
  EXW59_RS24490 (EXW59_25045) - 3922895..3923119 (-) 225 WP_215559963.1 hypothetical protein -
  EXW59_RS24495 (EXW59_25050) - 3923823..3924281 (-) 459 WP_215559964.1 hypothetical protein -
  EXW59_RS24500 (EXW59_25055) - 3924364..3925155 (-) 792 WP_215559965.1 prohibitin family protein -
  EXW59_RS24505 (EXW59_25060) - 3925332..3925799 (-) 468 WP_215559966.1 LacI family transcriptional regulator -
  EXW59_RS24510 (EXW59_25065) - 3925838..3926293 (-) 456 WP_215559967.1 nucleoside triphosphate pyrophosphohydrolase family protein -
  EXW59_RS24515 (EXW59_25070) - 3926320..3926793 (-) 474 WP_215559968.1 sugar ABC transporter substrate-binding protein -
  EXW59_RS24520 (EXW59_25075) - 3926819..3926986 (-) 168 WP_078204465.1 DUF3954 domain-containing protein -
  EXW59_RS24525 (EXW59_25080) - 3927004..3927363 (-) 360 WP_215559969.1 cell division protein SepF -
  EXW59_RS24530 (EXW59_25085) abrB 3927356..3927634 (-) 279 WP_215559970.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Regulator
  EXW59_RS24535 (EXW59_25090) - 3927650..3927844 (-) 195 WP_215559971.1 hypothetical protein -

Sequence

Protein


Download         Length: 92 a.a.        Molecular weight: 10013.58 Da        Isoelectric Point: 6.2246

>NTDB_id=346536 EXW59_RS24530 WP_215559970.1 3927356..3927634(-) (abrB) [Bacillus mycoides strain JAS1004]
MKNTGVARKVDELGRVVIPVELRRTLGIAEGTALDIHVDGENIVLRKHEKSCFVTGEVSESNLELLGGRMFLSKEGASEL
LDLLQKSGMVHA

Nucleotide


Download         Length: 279 bp        

>NTDB_id=346536 EXW59_RS24530 WP_215559970.1 3927356..3927634(-) (abrB) [Bacillus mycoides strain JAS1004]
ATGAAAAACACAGGTGTTGCAAGAAAAGTTGATGAGTTAGGGCGTGTAGTAATTCCGGTTGAGTTACGCAGAACTTTGGG
AATTGCTGAAGGAACAGCATTAGACATTCATGTTGATGGGGAAAACATCGTTTTAAGAAAACATGAAAAGTCATGCTTTG
TAACAGGTGAAGTTTCTGAATCAAACTTGGAATTGTTGGGTGGCCGAATGTTTTTGAGCAAGGAAGGCGCAAGTGAATTA
CTGGACCTTCTTCAGAAGAGTGGGATGGTACATGCCTAA

Domains

Predicted by InterproScan.

Antidote-toxin recognition MazE, bacterial antitoxin (MazE_antitoxin)

(8-49)

AbrB C-terminal domain (AbrB_C)

(52-86)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  abrB Bacillus subtilis subsp. subtilis str. 168

62.069

94.565

0.587

Multiple sequence alignment