Detailed information    

insolico Bioinformatically predicted

Overview


Name   abrB   Type   Regulator
Locus tag   EXW38_RS02435 Genome accession   NZ_CP036026
Coordinates   467383..467661 (+) Length   92 a.a.
NCBI ID   WP_215572336.1    Uniprot ID   -
Organism   Bacillus mycoides strain BPN54/2     
Function   repression of comK; repression of rok (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 456572..496953 467383..467661 within 0


Gene organization within MGE regions


Location: 456572..496953
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EXW38_RS02350 (EXW38_02390) - 456572..457696 (-) 1125 WP_215572322.1 site-specific integrase -
  EXW38_RS02355 (EXW38_02395) - 457961..458617 (-) 657 WP_215572323.1 hypothetical protein -
  EXW38_RS02360 (EXW38_02400) - 458929..459492 (-) 564 WP_215572324.1 DUF4352 domain-containing protein -
  EXW38_RS02365 (EXW38_02405) - 459627..459971 (-) 345 WP_098168470.1 DUF4064 domain-containing protein -
  EXW38_RS02370 (EXW38_02410) - 459996..460523 (-) 528 WP_215572325.1 DUF4352 domain-containing protein -
  EXW38_RS02375 (EXW38_02415) - 460739..461083 (-) 345 WP_215572326.1 helix-turn-helix domain-containing protein -
  EXW38_RS02380 (EXW38_02420) - 461574..462731 (+) 1158 WP_215572327.1 AimR family lysis-lysogeny pheromone receptor -
  EXW38_RS02385 - 462738..462887 (+) 150 WP_215572328.1 hypothetical protein -
  EXW38_RS02390 (EXW38_02425) - 463155..463505 (-) 351 WP_215572329.1 helix-turn-helix domain-containing protein -
  EXW38_RS02395 (EXW38_02430) - 463687..463920 (+) 234 WP_215572330.1 helix-turn-helix domain-containing protein -
  EXW38_RS02400 (EXW38_02435) - 463948..464679 (+) 732 WP_215572331.1 ORF6C domain-containing protein -
  EXW38_RS02405 (EXW38_02440) - 464726..465076 (+) 351 WP_215572332.1 helix-turn-helix domain-containing protein -
  EXW38_RS02410 - 465073..465237 (+) 165 WP_215572972.1 hypothetical protein -
  EXW38_RS02415 (EXW38_02445) - 465270..465452 (+) 183 WP_215572973.1 hypothetical protein -
  EXW38_RS02420 (EXW38_02450) - 465459..466343 (+) 885 WP_215572333.1 DnaD domain-containing protein -
  EXW38_RS02425 (EXW38_02455) - 466282..467157 (+) 876 WP_215572334.1 ATP-binding protein -
  EXW38_RS02430 (EXW38_02460) - 467173..467367 (+) 195 WP_215572335.1 hypothetical protein -
  EXW38_RS02435 (EXW38_02465) abrB 467383..467661 (+) 279 WP_215572336.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Regulator
  EXW38_RS02440 (EXW38_02470) - 467654..468013 (+) 360 WP_215572337.1 cell division protein SepF -
  EXW38_RS02445 (EXW38_02475) - 468032..468199 (+) 168 WP_002192984.1 DUF3954 domain-containing protein -
  EXW38_RS02450 (EXW38_02480) - 468225..468476 (+) 252 WP_215572338.1 helix-turn-helix domain containing protein -
  EXW38_RS02455 (EXW38_02485) - 468494..468949 (+) 456 WP_215572339.1 nucleoside triphosphate pyrophosphohydrolase family protein -
  EXW38_RS02460 - 468986..469123 (+) 138 WP_215572340.1 hypothetical protein -
  EXW38_RS02465 (EXW38_02490) - 469166..469513 (+) 348 WP_235713374.1 hypothetical protein -
  EXW38_RS02470 (EXW38_02495) - 469689..469991 (+) 303 WP_088099820.1 hypothetical protein -
  EXW38_RS02475 (EXW38_02500) - 470272..470535 (+) 264 WP_215572341.1 hypothetical protein -
  EXW38_RS02480 (EXW38_02505) - 470783..470977 (+) 195 WP_215572342.1 hypothetical protein -
  EXW38_RS02485 (EXW38_02510) - 471014..471376 (+) 363 WP_215572974.1 hypothetical protein -
  EXW38_RS02490 - 471406..471564 (+) 159 WP_215572343.1 hypothetical protein -
  EXW38_RS02495 (EXW38_02515) - 471645..471854 (+) 210 WP_215572344.1 hypothetical protein -
  EXW38_RS02500 (EXW38_02520) - 471899..472021 (+) 123 WP_215572345.1 DUF3983 domain-containing protein -
  EXW38_RS02505 (EXW38_02525) - 472042..472224 (+) 183 WP_215572346.1 hypothetical protein -
  EXW38_RS02510 - 472336..472506 (+) 171 WP_083596019.1 hypothetical protein -
  EXW38_RS02515 (EXW38_02530) - 472534..473016 (+) 483 WP_215572347.1 ArpU family phage packaging/lysis transcriptional regulator -
  EXW38_RS02520 (EXW38_02535) - 473016..473558 (+) 543 WP_002010102.1 site-specific integrase -
  EXW38_RS02525 (EXW38_02540) - 473790..474521 (+) 732 WP_215572348.1 hypothetical protein -
  EXW38_RS02530 (EXW38_02545) - 474524..475273 (+) 750 WP_215572349.1 Panacea domain-containing protein -
  EXW38_RS02535 (EXW38_02550) - 475727..476011 (+) 285 WP_215572915.1 hypothetical protein -
  EXW38_RS02540 (EXW38_02555) - 476094..476390 (+) 297 WP_215572975.1 hypothetical protein -
  EXW38_RS02545 (EXW38_02560) - 476353..476577 (+) 225 WP_235713375.1 helix-turn-helix domain-containing protein -
  EXW38_RS02550 (EXW38_02565) - 476565..476891 (+) 327 WP_215572351.1 HNH endonuclease -
  EXW38_RS02555 (EXW38_02570) - 476951..477196 (+) 246 WP_215572916.1 hypothetical protein -
  EXW38_RS02560 (EXW38_02575) - 477498..477998 (+) 501 WP_215572352.1 P27 family phage terminase small subunit -
  EXW38_RS02565 (EXW38_02580) - 477982..479640 (+) 1659 WP_215572353.1 terminase large subunit domain-containing protein -
  EXW38_RS02570 (EXW38_02585) - 479659..480885 (+) 1227 WP_215572354.1 phage portal protein -
  EXW38_RS02575 (EXW38_02590) - 480839..481552 (+) 714 WP_215572355.1 head maturation protease, ClpP-related -
  EXW38_RS02580 (EXW38_02595) - 481569..482693 (+) 1125 WP_215572356.1 phage major capsid protein -
  EXW38_RS02585 (EXW38_02600) - 482710..483033 (+) 324 WP_215572357.1 hypothetical protein -
  EXW38_RS02590 (EXW38_02605) - 483023..483379 (+) 357 WP_215572358.1 phage head-tail adapter protein -
  EXW38_RS02595 (EXW38_02610) - 483366..483746 (+) 381 WP_215572359.1 hypothetical protein -
  EXW38_RS02600 (EXW38_02615) - 483736..484146 (+) 411 WP_215572360.1 hypothetical protein -
  EXW38_RS02605 (EXW38_02620) - 484147..484713 (+) 567 WP_215572361.1 phage tail protein -
  EXW38_RS02610 (EXW38_02625) - 484785..485153 (+) 369 WP_078204757.1 hypothetical protein -
  EXW38_RS02615 (EXW38_02630) - 485335..489120 (+) 3786 WP_215572362.1 phage tail tape measure protein -
  EXW38_RS02620 (EXW38_02635) - 489113..489799 (+) 687 WP_215572363.1 distal tail protein Dit -
  EXW38_RS02625 (EXW38_02640) - 489796..491787 (+) 1992 WP_235713376.1 phage tail spike protein -
  EXW38_RS02630 (EXW38_02645) - 491797..492066 (+) 270 WP_215572364.1 transcriptional regulator -
  EXW38_RS02635 (EXW38_02650) - 492085..494595 (+) 2511 WP_215572365.1 BppU family phage baseplate upper protein -
  EXW38_RS02640 (EXW38_02655) - 494687..495646 (+) 960 WP_215572366.1 tyrosine-type recombinase/integrase -
  EXW38_RS02645 (EXW38_02660) - 495660..495941 (+) 282 WP_215572367.1 hypothetical protein -
  EXW38_RS02650 (EXW38_02665) - 495944..496168 (+) 225 WP_001131589.1 hypothetical protein -
  EXW38_RS02655 (EXW38_02670) - 496168..496953 (+) 786 WP_215572368.1 N-acetylmuramoyl-L-alanine amidase -

Sequence


Protein


Download         Length: 92 a.a.        Molecular weight: 9976.46 Da        Isoelectric Point: 6.2246

>NTDB_id=346016 EXW38_RS02435 WP_215572336.1 467383..467661(+) (abrB) [Bacillus mycoides strain BPN54/2]
MKNTGVARKVDDLGRVVIPVELRRTLGIAEGTSLDFHVDGENIVLRKHEKSCFVTGEVSESNIELLSGRMFLSKEGASEL
LGLLEKSGIAHA

Nucleotide


Download         Length: 279 bp        

>NTDB_id=346016 EXW38_RS02435 WP_215572336.1 467383..467661(+) (abrB) [Bacillus mycoides strain BPN54/2]
GTGAAAAACACAGGTGTTGCAAGAAAAGTGGACGATCTAGGGCGTGTAGTAATTCCAGTAGAGTTACGCAGAACTTTGGG
AATTGCTGAAGGAACATCATTAGACTTTCATGTTGATGGGGAAAACATCGTTTTAAGAAAACATGAAAAGTCATGTTTTG
TAACAGGTGAAGTTTCTGAATCAAACATAGAATTGCTGAGCGGACGAATGTTTTTGAGCAAGGAAGGGGCAAGTGAGTTA
CTGGGCCTTCTTGAAAAGAGTGGGATAGCACATGCCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  abrB Bacillus subtilis subsp. subtilis str. 168

57.831

90.217

0.522


Multiple sequence alignment