Detailed information    

insolico Bioinformatically predicted

Overview

Name   abrB   Type   Regulator
Locus tag   EXW27_RS27375 Genome accession   NZ_CP035999
Coordinates   5310078..5310356 (+) Length   92 a.a.
NCBI ID   WP_147740488.1    Uniprot ID   -
Organism   Bacillus mycoides strain BPN37/1     
Function   repression of comK; repression of rok (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 5302583..5322328 5310078..5310356 within 0


Gene organization within MGE regions


Location: 5302583..5322328
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EXW27_RS27315 (EXW27_27765) - 5302583..5303689 (-) 1107 WP_147740478.1 site-specific integrase -
  EXW27_RS27320 (EXW27_27770) - 5304424..5305566 (+) 1143 WP_147740479.1 AimR family lysis-lysogeny pheromone receptor -
  EXW27_RS27325 - 5305599..5305751 (+) 153 WP_179957919.1 hypothetical protein -
  EXW27_RS27330 (EXW27_27775) - 5306017..5306361 (-) 345 WP_147740480.1 helix-turn-helix domain-containing protein -
  EXW27_RS27335 (EXW27_27780) - 5306589..5306852 (+) 264 WP_147740481.1 helix-turn-helix domain-containing protein -
  EXW27_RS27340 (EXW27_27785) - 5306830..5307489 (+) 660 WP_147740482.1 Rha family transcriptional regulator -
  EXW27_RS27345 (EXW27_27790) - 5307530..5307796 (+) 267 WP_147740483.1 helix-turn-helix domain-containing protein -
  EXW27_RS27350 - 5307796..5307960 (+) 165 WP_179957920.1 hypothetical protein -
  EXW27_RS27355 (EXW27_27795) - 5307990..5308169 (+) 180 WP_147740484.1 hypothetical protein -
  EXW27_RS27360 (EXW27_27800) - 5308175..5309059 (+) 885 WP_215598708.1 conserved phage C-terminal domain-containing protein -
  EXW27_RS27365 (EXW27_27805) - 5309022..5309864 (+) 843 WP_370458405.1 ATP-binding protein -
  EXW27_RS27370 (EXW27_27810) - 5309867..5310061 (+) 195 WP_147740487.1 hypothetical protein -
  EXW27_RS27375 (EXW27_27815) abrB 5310078..5310356 (+) 279 WP_147740488.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Regulator
  EXW27_RS27380 (EXW27_27820) - 5310349..5310708 (+) 360 WP_147740489.1 cell division protein SepF -
  EXW27_RS27385 (EXW27_27825) - 5310727..5310894 (+) 168 WP_098297620.1 DUF3954 domain-containing protein -
  EXW27_RS27390 (EXW27_27830) - 5310920..5311171 (+) 252 WP_147740490.1 helix-turn-helix domain containing protein -
  EXW27_RS27395 (EXW27_27835) - 5311189..5311644 (+) 456 WP_147740491.1 nucleoside triphosphate pyrophosphohydrolase family protein -
  EXW27_RS27400 (EXW27_27840) - 5311758..5312420 (-) 663 WP_147740492.1 exosporium leader peptide-containing protein -
  EXW27_RS27405 (EXW27_27845) - 5312659..5312979 (-) 321 WP_147740493.1 hypothetical protein -
  EXW27_RS27410 (EXW27_27850) dcm 5313192..5314598 (+) 1407 WP_235712305.1 DNA (cytosine-5-)-methyltransferase -
  EXW27_RS27415 (EXW27_27855) - 5314875..5315171 (-) 297 WP_215598709.1 hypothetical protein -
  EXW27_RS27420 - 5315320..5315493 (+) 174 WP_179957921.1 hypothetical protein -
  EXW27_RS27425 (EXW27_27860) - 5315512..5315634 (+) 123 WP_002010097.1 DUF3983 domain-containing protein -
  EXW27_RS27430 - 5315748..5315918 (+) 171 WP_215598701.1 hypothetical protein -
  EXW27_RS27435 (EXW27_27865) - 5315946..5316428 (+) 483 WP_078204473.1 ArpU family phage packaging/lysis transcriptional regulator -
  EXW27_RS27440 (EXW27_27870) - 5316428..5316970 (+) 543 WP_215598710.1 site-specific integrase -
  EXW27_RS27445 (EXW27_27875) - 5317290..5317460 (+) 171 WP_147740534.1 DUF4083 family protein -
  EXW27_RS27450 (EXW27_27880) - 5317509..5317859 (+) 351 WP_147740535.1 hypothetical protein -
  EXW27_RS27455 (EXW27_27885) - 5318060..5318592 (-) 533 Protein_5392 GrpB family protein -
  EXW27_RS27460 (EXW27_27890) - 5318914..5319294 (+) 381 WP_078178898.1 hypothetical protein -
  EXW27_RS27465 (EXW27_27895) - 5319584..5320306 (+) 723 WP_179957890.1 hypothetical protein -
  EXW27_RS27470 (EXW27_27900) - 5320680..5320883 (+) 204 WP_147740084.1 hypothetical protein -
  EXW27_RS27475 (EXW27_27905) - 5320890..5321141 (+) 252 WP_147740085.1 hypothetical protein -
  EXW27_RS27480 (EXW27_27910) - 5321143..5321328 (+) 186 WP_147740086.1 hypothetical protein -
  EXW27_RS27485 (EXW27_27915) - 5321318..5321695 (+) 378 WP_147740087.1 HNH endonuclease -
  EXW27_RS27490 (EXW27_27920) - 5321825..5322328 (+) 504 WP_061675010.1 phage terminase small subunit P27 family -

Sequence

Protein


Download         Length: 92 a.a.        Molecular weight: 10094.63 Da        Isoelectric Point: 6.2246

>NTDB_id=345753 EXW27_RS27375 WP_147740488.1 5310078..5310356(+) (abrB) [Bacillus mycoides strain BPN37/1]
MKNTGVARKVDELGRVVIPVELRRTLGIAEGTALDFHVDGENIVLRKHEKSCFVTGEVSESNMELLNGRMFLSKEGASEL
LDLLQKSGMAHA

Nucleotide


Download         Length: 279 bp        

>NTDB_id=345753 EXW27_RS27375 WP_147740488.1 5310078..5310356(+) (abrB) [Bacillus mycoides strain BPN37/1]
ATGAAAAATACAGGTGTTGCAAGAAAAGTGGACGAGCTAGGGCGTGTAGTAATTCCGGTAGAGTTACGCAGAACTTTGGG
AATTGCTGAAGGAACAGCACTAGACTTTCATGTTGATGGGGAAAACATCGTTTTAAGAAAACATGAAAAGTCATGCTTTG
TAACTGGTGAAGTTTCTGAATCAAACATGGAATTGCTCAATGGTCGAATGTTTTTGAGCAAAGAAGGCGCAAGTGAATTA
CTGGACCTTCTTCAGAAGAGTGGGATGGCACATGCCTAA

Domains

Predicted by InterproScan.

Antidote-toxin recognition MazE, bacterial antitoxin (MazE_antitoxin)

(8-49)

AbrB C-terminal domain (AbrB_C)

(52-86)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  abrB Bacillus subtilis subsp. subtilis str. 168

58.621

94.565

0.554

Multiple sequence alignment