Detailed information    

insolico Bioinformatically predicted

Overview

Name   abrB   Type   Regulator
Locus tag   EXW60_RS28185 Genome accession   NZ_CP035987
Coordinates   5527953..5528231 (-) Length   92 a.a.
NCBI ID   WP_002187129.1    Uniprot ID   R8CK50
Organism   Bacillus mycoides strain BPN29/1     
Function   repression of comK; repression of rok (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 5516424..5537577 5527953..5528231 within 0


Gene organization within MGE regions


Location: 5516424..5537577
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EXW60_RS28125 (EXW60_28790) - 5516424..5516978 (+) 555 WP_061676088.1 helix-turn-helix domain-containing protein -
  EXW60_RS28130 (EXW60_28795) - 5517128..5518555 (-) 1428 WP_061676087.1 S-layer homology domain-containing protein -
  EXW60_RS28135 (EXW60_28800) - 5519198..5520848 (+) 1651 Protein_5552 S-layer homology domain-containing protein -
  EXW60_RS29425 (EXW60_28805) - 5521464..5521673 (-) 210 WP_080448173.1 hypothetical protein -
  EXW60_RS28140 (EXW60_28810) - 5522314..5522613 (-) 300 WP_061676085.1 helix-turn-helix transcriptional regulator -
  EXW60_RS28145 (EXW60_28815) - 5523136..5523516 (+) 381 WP_201053812.1 DUF4878 domain-containing protein -
  EXW60_RS28150 (EXW60_28820) - 5523554..5524006 (-) 453 WP_016097074.1 SMI1/KNR4 family protein -
  EXW60_RS28155 (EXW60_28825) - 5524021..5524212 (-) 192 Protein_5557 HNH endonuclease -
  EXW60_RS28160 (EXW60_28830) - 5524748..5525260 (-) 513 WP_002187134.1 helix-turn-helix domain-containing protein -
  EXW60_RS28165 (EXW60_28835) - 5525282..5525632 (-) 351 WP_061676081.1 hypothetical protein -
  EXW60_RS28170 (EXW60_28840) - 5525863..5526906 (+) 1044 WP_016093774.1 site-specific integrase -
  EXW60_RS29870 - 5527198..5527254 (+) 57 Protein_5561 XRE family transcriptional regulator -
  EXW60_RS29875 - 5527261..5527443 (+) 183 WP_003193172.1 hypothetical protein -
  EXW60_RS28180 (EXW60_28850) - 5527683..5527895 (-) 213 WP_002187131.1 hypothetical protein -
  EXW60_RS28185 (EXW60_28855) abrB 5527953..5528231 (-) 279 WP_002187129.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Regulator
  EXW60_RS28190 (EXW60_28860) - 5528303..5528530 (-) 228 WP_002187128.1 hypothetical protein -
  EXW60_RS28195 (EXW60_28865) - 5528555..5528995 (-) 441 WP_061676080.1 hypothetical protein -
  EXW60_RS28200 (EXW60_28875) - 5529540..5529716 (-) 177 Protein_5567 zinc ribbon domain-containing protein -
  EXW60_RS28205 (EXW60_28880) - 5529842..5530549 (+) 708 WP_098168926.1 IS6 family transposase -
  EXW60_RS29440 (EXW60_28885) - 5530658..5530840 (-) 183 WP_080448182.1 hypothetical protein -
  EXW60_RS28210 (EXW60_28890) - 5531061..5531336 (-) 276 WP_003193761.1 hypothetical protein -
  EXW60_RS28215 (EXW60_28895) - 5531716..5532669 (-) 954 WP_016093785.1 nucleoside 2-deoxyribosyltransferase -
  EXW60_RS28220 (EXW60_28900) - 5532947..5533445 (-) 499 Protein_5572 DUF2716 domain-containing protein -
  EXW60_RS28225 - 5533527..5533601 (-) 75 Protein_5573 site-specific integrase -
  EXW60_RS28230 (EXW60_28905) - 5533608..5534071 (-) 464 Protein_5574 ArpU family phage packaging/lysis transcriptional regulator -
  EXW60_RS28235 (EXW60_28910) - 5534274..5534876 (-) 603 WP_002012554.1 DUF6944 family repetitive protein -
  EXW60_RS28240 (EXW60_28915) - 5535569..5536348 (+) 780 WP_215598610.1 BclA C-terminal domain-containing protein -
  EXW60_RS29445 - 5537051..5537206 (+) 156 Protein_5577 spore germination protein -
  EXW60_RS28250 (EXW60_28925) - 5537294..5537577 (-) 284 Protein_5578 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -

Sequence

Protein


Download         Length: 92 a.a.        Molecular weight: 10250.99 Da        Isoelectric Point: 5.8624

>NTDB_id=345599 EXW60_RS28185 WP_002187129.1 5527953..5528231(-) (abrB) [Bacillus mycoides strain BPN29/1]
MKSTGVTRKIDELGRIVLPKELRRTLGIAEKDPIEIFVDGEMIILQKYKSYDACTITGDISEKNISLGNGQIVLSPEGAE
LLIKEIQQHLVK

Nucleotide


Download         Length: 279 bp        

>NTDB_id=345599 EXW60_RS28185 WP_002187129.1 5527953..5528231(-) (abrB) [Bacillus mycoides strain BPN29/1]
ATGAAATCAACAGGTGTTACACGTAAAATAGATGAATTAGGGCGTATTGTTCTTCCGAAAGAGTTAAGAAGAACATTAGG
AATTGCAGAAAAAGATCCTATAGAAATATTTGTTGACGGTGAGATGATAATATTACAAAAATACAAGTCATATGATGCTT
GTACAATAACTGGTGATATTTCAGAAAAGAATATTTCATTAGGTAATGGACAAATTGTTCTTAGTCCTGAAGGGGCTGAA
CTTTTAATTAAGGAGATTCAGCAACACTTAGTGAAATAA

Domains

Predicted by InterproScan.

AbrB C-terminal domain (AbrB_C)

(53-89)

Antidote-toxin recognition MazE, bacterial antitoxin (MazE_antitoxin)

(8-50)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB R8CK50

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  abrB Bacillus subtilis subsp. subtilis str. 168

62.222

97.826

0.609

Multiple sequence alignment