Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   GFB63_RS02490 Genome accession   NZ_CP045596
Coordinates   496011..496250 (-) Length   79 a.a.
NCBI ID   WP_011681565.1    Uniprot ID   -
Organism   Streptococcus thermophilus strain TK-P3A     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context

Location: 491011..501250
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GFB63_RS02455 (GFB63_02530) - 491048..491428 (-) 381 WP_084829082.1 bacteriocin secretion protein -
  GFB63_RS02460 (GFB63_02535) - 491553..491816 (-) 264 WP_002945924.1 hypothetical protein -
  GFB63_RS02465 (GFB63_02540) - 492138..492434 (-) 297 WP_004197070.1 bacteriocin immunity protein -
  GFB63_RS02470 (GFB63_02545) - 492599..493525 (-) 927 WP_022096485.1 thioredoxin family protein -
  GFB63_RS02480 (GFB63_02555) - 495399..495578 (-) 180 WP_011681564.1 hypothetical protein -
  GFB63_RS02485 (GFB63_02560) - 495607..495999 (-) 393 WP_003094909.1 hypothetical protein -
  GFB63_RS02490 (GFB63_02565) cipB 496011..496250 (-) 240 WP_011681565.1 Blp family class II bacteriocin Regulator
  GFB63_RS02495 (GFB63_02570) - 496606..496806 (-) 201 WP_011681569.1 hypothetical protein -
  GFB63_RS02500 (GFB63_02580) - 496889..497071 (+) 183 Protein_507 IS3 family transposase -
  GFB63_RS02505 (GFB63_02585) - 497217..497459 (-) 243 WP_011227518.1 Blp family class II bacteriocin -
  GFB63_RS11030 (GFB63_02590) - 497710..498111 (-) 402 WP_011226490.1 hypothetical protein -
  GFB63_RS02510 - 498966..499109 (-) 144 WP_014608661.1 hypothetical protein -
  GFB63_RS02515 (GFB63_02600) - 499116..499346 (-) 231 WP_011226494.1 bacteriocin class II family protein -
  GFB63_RS02520 (GFB63_02605) - 499702..499902 (-) 201 WP_011681569.1 hypothetical protein -
  GFB63_RS02525 (GFB63_02610) - 499921..500097 (-) 177 WP_011681570.1 Blp family class II bacteriocin -
  GFB63_RS02530 (GFB63_02615) - 500348..501085 (+) 738 WP_024010062.1 LytTR family DNA-binding domain-containing protein -

Sequence

Protein


Download         Length: 79 a.a.        Molecular weight: 7727.69 Da        Isoelectric Point: 3.8735

>NTDB_id=345190 GFB63_RS02490 WP_011681565.1 496011..496250(-) (cipB) [Streptococcus thermophilus strain TK-P3A]
MATQTIENFNTLDLETLASVEGGRVNWERWGMCGASVAVGASEGFSAAAGGTAFFIGPYAIGTGAVGAAIGGGVALLGC

Nucleotide


Download         Length: 240 bp        

>NTDB_id=345190 GFB63_RS02490 WP_011681565.1 496011..496250(-) (cipB) [Streptococcus thermophilus strain TK-P3A]
ATGGCAACTCAAACAATTGAAAACTTTAACACCCTCGACCTTGAAACACTTGCTAGTGTTGAAGGAGGACGAGTCAATTG
GGAACGATGGGGAATGTGTGGGGCCTCTGTCGCCGTAGGTGCTTCAGAAGGATTCTCTGCAGCTGCAGGTGGAACGGCTT
TCTTCATTGGACCGTATGCAATTGGAACTGGTGCAGTAGGTGCAGCTATTGGAGGTGGAGTAGCCTTACTTGGCTGTTAA

Domains

Predicted by InterProScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(7-74)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

52.459

77.215

0.405

Multiple sequence alignment