Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   FPL20_RS08295 Genome accession   NZ_CP045478
Coordinates   1597525..1597665 (+) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain JD-014     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 1592525..1602665
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FPL20_RS08265 (FPL20_GE01557) yueI 1592820..1593218 (+) 399 WP_003242987.1 YueI family protein -
  FPL20_RS08270 (FPL20_GE01558) pncA 1593315..1593866 (+) 552 WP_003243099.1 cysteine hydrolase family protein -
  FPL20_RS08275 (FPL20_GE01559) pncB 1593882..1595354 (+) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  FPL20_RS08280 (FPL20_GE01560) pdeH 1595491..1596720 (+) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  FPL20_RS08285 (FPL20_GE01561) - 1596696..1597064 (-) 369 WP_003243784.1 hypothetical protein -
  FPL20_RS08290 - 1597178..1597303 (-) 126 WP_003228793.1 hypothetical protein -
  FPL20_RS08295 (FPL20_GE01562) degQ 1597525..1597665 (+) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  FPL20_RS08300 (FPL20_GE01563) comQ 1597850..1598749 (+) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  FPL20_RS08305 (FPL20_GE01564) comX 1598737..1598904 (+) 168 WP_003242801.1 competence pheromone ComX Regulator
  FPL20_RS08310 comP 1598919..1601227 (+) 2309 Protein_1599 two-component system sensor histidine kinase ComP -
  FPL20_RS08315 (FPL20_GE01567) comA 1601308..1601952 (+) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  FPL20_RS08320 (FPL20_GE01568) yuxO 1601971..1602351 (+) 381 WP_003228810.1 hotdog fold thioesterase -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=344684 FPL20_RS08295 WP_003220708.1 1597525..1597665(+) (degQ) [Bacillus subtilis strain JD-014]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=344684 FPL20_RS08295 WP_003220708.1 1597525..1597665(+) (degQ) [Bacillus subtilis strain JD-014]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment