Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | GCU76_RS13385 | Genome accession | NZ_CP045425 |
| Coordinates | 2471118..2471291 (+) | Length | 57 a.a. |
| NCBI ID | WP_003230187.1 | Uniprot ID | A0ABU0V3E4 |
| Organism | Bacillus subtilis strain JAAA | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2466118..2476291
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GCU76_RS13370 | gcvT | 2466918..2468006 (-) | 1089 | WP_017696204.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| GCU76_RS13375 | hepAA | 2468447..2470120 (+) | 1674 | WP_017696203.1 | SNF2-related protein | - |
| GCU76_RS13380 | yqhG | 2470141..2470935 (+) | 795 | WP_017696202.1 | YqhG family protein | - |
| GCU76_RS13385 | sinI | 2471118..2471291 (+) | 174 | WP_003230187.1 | anti-repressor SinI | Regulator |
| GCU76_RS13390 | sinR | 2471325..2471660 (+) | 336 | WP_003226345.1 | transcriptional regulator SinR | Regulator |
| GCU76_RS13395 | tasA | 2471753..2472538 (-) | 786 | WP_041053490.1 | biofilm matrix protein TasA | - |
| GCU76_RS13400 | sipW | 2472602..2473174 (-) | 573 | WP_080333421.1 | signal peptidase I SipW | - |
| GCU76_RS13405 | tapA | 2473158..2473913 (-) | 756 | WP_017696199.1 | amyloid fiber anchoring/assembly protein TapA | - |
| GCU76_RS13410 | yqzG | 2474184..2474510 (+) | 327 | WP_026113671.1 | YqzG/YhdC family protein | - |
| GCU76_RS13415 | spoIITA | 2474552..2474731 (-) | 180 | WP_014480252.1 | YqzE family protein | - |
| GCU76_RS13420 | comGG | 2474802..2475176 (-) | 375 | WP_017696197.1 | ComG operon protein ComGG | Machinery gene |
| GCU76_RS13425 | comGF | 2475177..2475560 (-) | 384 | WP_017696196.1 | ComG operon protein ComGF | Machinery gene |
| GCU76_RS13430 | comGE | 2475586..2475933 (-) | 348 | WP_017696195.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6601.52 Da Isoelectric Point: 6.7231
>NTDB_id=344221 GCU76_RS13385 WP_003230187.1 2471118..2471291(+) (sinI) [Bacillus subtilis strain JAAA]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=344221 GCU76_RS13385 WP_003230187.1 2471118..2471291(+) (sinI) [Bacillus subtilis strain JAAA]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
100 |
100 |
1 |