Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   F8M43_RS16580 Genome accession   NZ_CP044498
Coordinates   3155110..3155250 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain ms-2     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3150110..3160250
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  F8M43_RS16555 yuxO 3150386..3150766 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  F8M43_RS16560 comA 3150785..3151429 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  F8M43_RS16565 comP 3151510..3153822 (-) 2313 WP_068947635.1 histidine kinase Regulator
  F8M43_RS16570 comX 3153838..3154059 (-) 222 WP_014114983.1 competence pheromone ComX -
  F8M43_RS16575 comQ 3154056..3154925 (-) 870 WP_015714626.1 polyprenyl synthetase family protein Regulator
  F8M43_RS16580 degQ 3155110..3155250 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  F8M43_RS16585 - 3155472..3155597 (+) 126 WP_121549029.1 hypothetical protein -
  F8M43_RS16590 - 3155712..3156080 (+) 369 WP_038427878.1 hypothetical protein -
  F8M43_RS16595 pdeH 3156056..3157285 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  F8M43_RS16600 pncB 3157422..3158894 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  F8M43_RS16605 pncA 3158910..3159461 (-) 552 WP_014477836.1 isochorismatase family cysteine hydrolase -
  F8M43_RS16610 yueI 3159558..3159956 (-) 399 WP_015251331.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=343260 F8M43_RS16580 WP_003220708.1 3155110..3155250(-) (degQ) [Bacillus subtilis strain ms-2]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=343260 F8M43_RS16580 WP_003220708.1 3155110..3155250(-) (degQ) [Bacillus subtilis strain ms-2]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1