Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   F8M43_RS12600 Genome accession   NZ_CP044498
Coordinates   2435515..2435688 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0ABU0V3E4
Organism   Bacillus subtilis strain ms-2     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2430515..2440688
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  F8M43_RS12585 gcvT 2431315..2432403 (-) 1089 WP_015714248.1 glycine cleavage system aminomethyltransferase GcvT -
  F8M43_RS12590 hepAA 2432844..2434517 (+) 1674 WP_029726726.1 SNF2-related protein -
  F8M43_RS12595 yqhG 2434538..2435332 (+) 795 WP_015714249.1 YqhG family protein -
  F8M43_RS12600 sinI 2435515..2435688 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  F8M43_RS12605 sinR 2435722..2436057 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  F8M43_RS12610 tasA 2436150..2436935 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  F8M43_RS12615 sipW 2436999..2437571 (-) 573 WP_072692741.1 signal peptidase I SipW -
  F8M43_RS12620 tapA 2437555..2438316 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  F8M43_RS12625 yqzG 2438587..2438913 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  F8M43_RS12630 spoIITA 2438955..2439134 (-) 180 WP_029726723.1 YqzE family protein -
  F8M43_RS12635 comGG 2439206..2439580 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  F8M43_RS12640 comGF 2439581..2439964 (-) 384 WP_029726721.1 ComG operon protein ComGF Machinery gene
  F8M43_RS12645 comGE 2439990..2440337 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=343224 F8M43_RS12600 WP_003230187.1 2435515..2435688(+) (sinI) [Bacillus subtilis strain ms-2]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=343224 F8M43_RS12600 WP_003230187.1 2435515..2435688(+) (sinI) [Bacillus subtilis strain ms-2]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1