Detailed information    

insolico Bioinformatically predicted

Overview


Name   comC/blpC   Type   Regulator
Locus tag   FSA28_RS09055 Genome accession   NZ_CP044495
Coordinates   1798902..1799042 (+) Length   46 a.a.
NCBI ID   WP_002270250.1    Uniprot ID   Q9APK7
Organism   Streptococcus mutans strain UA140     
Function   binding to ComD; induce autophosphorylation of ComD; regulation of comX expression (predicted from homology)   
Competence regulation

Genomic Context


Location: 1793902..1804042
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FSA28_RS09025 (FSA28_1569) - 1794857..1795871 (+) 1015 Protein_1678 HlyD family efflux transporter periplasmic adaptor subunit -
  FSA28_RS09030 (FSA28_1570) - 1796133..1796276 (-) 144 WP_002263740.1 hypothetical protein -
  FSA28_RS09040 (FSA28_1571) - 1796567..1797589 (-) 1023 WP_002351359.1 thioredoxin family protein -
  FSA28_RS09045 (FSA28_1572) - 1798071..1798259 (-) 189 WP_002284747.1 Blp family class II bacteriocin -
  FSA28_RS09050 (FSA28_1573) - 1798423..1798636 (-) 214 Protein_1682 Blp family class II bacteriocin -
  FSA28_RS09055 (FSA28_1574) comC/blpC 1798902..1799042 (+) 141 WP_002270250.1 ComC/BlpC family leader-containing pheromone/bacteriocin Regulator
  FSA28_RS09060 (FSA28_1575) comD/blpH 1799184..1800509 (-) 1326 WP_002292008.1 sensor histidine kinase Regulator
  FSA28_RS09065 (FSA28_1576) comE/blpR 1800506..1801258 (-) 753 WP_002262114.1 response regulator transcription factor Regulator
  FSA28_RS09070 (FSA28_1577) - 1801730..1802368 (-) 639 WP_002292006.1 VTT domain-containing protein -
  FSA28_RS09075 (FSA28_1578) - 1802416..1803042 (-) 627 WP_002268642.1 hypothetical protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5195.02 Da        Isoelectric Point: 10.4929

>NTDB_id=343054 FSA28_RS09055 WP_002270250.1 1798902..1799042(+) (comC/blpC) [Streptococcus mutans strain UA140]
MKKTPSLKNDFKEIKTDELEIIIGGSGSLSTFFRLFNRSFTQALGK

Nucleotide


Download         Length: 141 bp        

>NTDB_id=343054 FSA28_RS09055 WP_002270250.1 1798902..1799042(+) (comC/blpC) [Streptococcus mutans strain UA140]
ATGAAAAAAACACCATCATTAAAAAATGACTTTAAAGAAATTAAGACTGATGAATTAGAGATTATCATTGGCGGAAGCGG
AAGCCTATCAACATTTTTCCGGCTGTTTAACAGAAGTTTTACACAAGCTTTGGGAAAATAA

Domains


Predicted by InterProScan.

(1-32)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q9APK7

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comC/blpC Streptococcus mutans UA159

97.826

100

0.978