Detailed information
Overview
| Name | comC/blpC | Type | Regulator |
| Locus tag | FSA31_RS08640 | Genome accession | NZ_CP044492 |
| Coordinates | 1726310..1726450 (+) | Length | 46 a.a. |
| NCBI ID | WP_002270250.1 | Uniprot ID | Q9APK7 |
| Organism | Streptococcus mutans strain T8 | ||
| Function | binding to ComD; induce autophosphorylation of ComD; regulation of comX expression (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1721310..1731450
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FSA31_RS08610 (FSA31_1705) | - | 1722337..1723279 (+) | 943 | Protein_1608 | HlyD family efflux transporter periplasmic adaptor subunit | - |
| FSA31_RS08615 (FSA31_1706) | - | 1723540..1723683 (-) | 144 | WP_002263740.1 | hypothetical protein | - |
| FSA31_RS08625 (FSA31_1707) | - | 1723975..1724997 (-) | 1023 | WP_002284748.1 | thioredoxin family protein | - |
| FSA31_RS08630 (FSA31_1708) | - | 1725478..1725666 (-) | 189 | WP_002284747.1 | Blp family class II bacteriocin | - |
| FSA31_RS08635 (FSA31_1709) | cipB | 1725834..1726043 (-) | 210 | WP_002268232.1 | Blp family class II bacteriocin | Regulator |
| FSA31_RS08640 (FSA31_1710) | comC/blpC | 1726310..1726450 (+) | 141 | WP_002270250.1 | ComC/BlpC family leader-containing pheromone/bacteriocin | Regulator |
| FSA31_RS08645 (FSA31_1711) | comD/blpH | 1726592..1727917 (-) | 1326 | WP_002284746.1 | GHKL domain-containing protein | Regulator |
| FSA31_RS08650 (FSA31_1712) | comE/blpR | 1727914..1728666 (-) | 753 | WP_002284745.1 | response regulator transcription factor | Regulator |
| FSA31_RS08655 (FSA31_1713) | - | 1729131..1729769 (-) | 639 | WP_002262115.1 | VTT domain-containing protein | - |
| FSA31_RS08660 (FSA31_1714) | - | 1729817..1730443 (-) | 627 | WP_002268642.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5195.02 Da Isoelectric Point: 10.4929
>NTDB_id=342831 FSA31_RS08640 WP_002270250.1 1726310..1726450(+) (comC/blpC) [Streptococcus mutans strain T8]
MKKTPSLKNDFKEIKTDELEIIIGGSGSLSTFFRLFNRSFTQALGK
MKKTPSLKNDFKEIKTDELEIIIGGSGSLSTFFRLFNRSFTQALGK
Nucleotide
Download Length: 141 bp
>NTDB_id=342831 FSA31_RS08640 WP_002270250.1 1726310..1726450(+) (comC/blpC) [Streptococcus mutans strain T8]
ATGAAAAAAACACCATCATTAAAAAATGACTTTAAAGAAATTAAGACTGATGAATTAGAGATTATCATTGGCGGAAGCGG
AAGCCTATCAACATTTTTCCGGCTGTTTAACAGAAGTTTTACACAAGCTTTGGGAAAATAA
ATGAAAAAAACACCATCATTAAAAAATGACTTTAAAGAAATTAAGACTGATGAATTAGAGATTATCATTGGCGGAAGCGG
AAGCCTATCAACATTTTTCCGGCTGTTTAACAGAAGTTTTACACAAGCTTTGGGAAAATAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC/blpC | Streptococcus mutans UA159 |
97.826 |
100 |
0.978 |