Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   F7V86_RS09090 Genome accession   NZ_CP044444
Coordinates   1756443..1756562 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   A7Z1C5
Organism   Bacillus amyloliquefaciens strain KC41     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 1751443..1761562
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  F7V86_RS09075 - 1753055..1753738 (+) 684 WP_014416901.1 response regulator transcription factor -
  F7V86_RS09080 - 1753725..1755152 (+) 1428 WP_106067998.1 HAMP domain-containing sensor histidine kinase -
  F7V86_RS09085 rapC 1755311..1756459 (+) 1149 WP_003156336.1 Rap family tetratricopeptide repeat protein Regulator
  F7V86_RS09090 phrC 1756443..1756562 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  F7V86_RS09095 - 1756712..1756822 (-) 111 WP_369719092.1 YjcZ family sporulation protein -
  F7V86_RS09100 - 1756902..1758266 (-) 1365 WP_017419273.1 aspartate kinase -
  F7V86_RS09105 ceuB 1758680..1759633 (+) 954 WP_014416904.1 ABC transporter permease Machinery gene
  F7V86_RS09110 - 1759623..1760570 (+) 948 WP_014416905.1 iron chelate uptake ABC transporter family permease subunit -
  F7V86_RS09115 - 1760564..1761322 (+) 759 WP_022552588.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=342657 F7V86_RS09090 WP_003156334.1 1756443..1756562(+) (phrC) [Bacillus amyloliquefaciens strain KC41]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=342657 F7V86_RS09090 WP_003156334.1 1756443..1756562(+) (phrC) [Bacillus amyloliquefaciens strain KC41]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A7Z1C5

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718