Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   F5989_RS04425 Genome accession   NZ_CP044221
Coordinates   915262..915492 (-) Length   76 a.a.
NCBI ID   WP_002275977.1    Uniprot ID   Q8DVP7
Organism   Streptococcus mutans strain NCH105     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context

Location: 910262..920492
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  F5989_RS04400 (F5989_04465) - 910292..910813 (+) 522 WP_002275391.1 YgjV family protein -
  F5989_RS04405 (F5989_04470) - 910920..911741 (-) 822 WP_032497911.1 Cof-type HAD-IIB family hydrolase -
  F5989_RS04410 (F5989_04475) copZ 911987..912190 (-) 204 WP_002263706.1 copper chaperone CopZ -
  F5989_RS04415 (F5989_04480) - 912203..914431 (-) 2229 WP_002289729.1 heavy metal translocating P-type ATPase -
  F5989_RS04420 (F5989_04485) - 914428..914871 (-) 444 WP_002267007.1 CopY/TcrY family copper transport repressor -
  F5989_RS04425 (F5989_04490) cipB 915262..915492 (-) 231 WP_002275977.1 bacteriocin class II family protein Regulator
  F5989_RS10345 - 915760..915894 (+) 135 WP_002267544.1 hypothetical protein -
  F5989_RS04430 (F5989_04495) rbfA 915972..916322 (-) 351 WP_002289840.1 30S ribosome-binding factor RbfA -
  F5989_RS04435 (F5989_04500) infB 916556..918778 (-) 2223 Protein_853 translation initiation factor IF-2 -
  F5989_RS10415 - 919214..919306 (-) 93 Protein_854 translation initiation factor IF-2 N-terminal domain-containing protein -
  F5989_RS04440 (F5989_04505) - 919327..919629 (-) 303 WP_002262601.1 YlxQ-related RNA-binding protein -
  F5989_RS04445 (F5989_04510) rnpM 919622..919918 (-) 297 WP_002263922.1 RNase P modulator RnpM -

Sequence

Protein


Download         Length: 76 a.a.        Molecular weight: 7229.19 Da        Isoelectric Point: 3.7781

>NTDB_id=341601 F5989_RS04425 WP_002275977.1 915262..915492(-) (cipB) [Streptococcus mutans strain NCH105]
MNTQAFEQFNVMDNEALSTVEGGGMIRCALGTAGSAGLGFVGGMGAGTVTLPVVGTVSGAALGGWSGAAVGAATFC

Nucleotide


Download         Length: 231 bp        

>NTDB_id=341601 F5989_RS04425 WP_002275977.1 915262..915492(-) (cipB) [Streptococcus mutans strain NCH105]
ATGAATACACAAGCATTTGAACAATTTAACGTAATGGATAATGAAGCACTTTCAACTGTTGAGGGTGGTGGTATGATTAG
ATGTGCACTTGGCACAGCTGGTTCTGCAGGTTTAGGATTTGTAGGGGGTATGGGAGCTGGTACAGTTACTCTCCCAGTCG
TTGGTACAGTATCTGGAGCGGCTTTAGGAGGCTGGTCTGGAGCAGCTGTAGGTGCTGCTACTTTTTGTTGA

Domains

Predicted by InterProScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-70)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB Q8DVP7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

71.429

55.263

0.395