Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | F5K02_RS16170 | Genome accession | NZ_CP044132 |
| Coordinates | 3257008..3257148 (-) | Length | 46 a.a. |
| NCBI ID | WP_003152043.1 | Uniprot ID | A3KLB4 |
| Organism | Bacillus amyloliquefaciens strain ZKY01 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3252008..3262148
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| F5K02_RS16145 (F5K02_16245) | - | 3252335..3252718 (-) | 384 | WP_007408674.1 | hotdog fold thioesterase | - |
| F5K02_RS16150 (F5K02_16250) | comA | 3252740..3253384 (-) | 645 | WP_003152052.1 | response regulator transcription factor | Regulator |
| F5K02_RS16155 (F5K02_16255) | comP | 3253465..3255771 (-) | 2307 | WP_094032817.1 | sensor histidine kinase | Regulator |
| F5K02_RS16160 (F5K02_16260) | comX | 3255790..3255966 (-) | 177 | WP_015240484.1 | competence pheromone ComX | - |
| F5K02_RS16165 (F5K02_16265) | comQ | 3255981..3256856 (-) | 876 | WP_025285191.1 | polyprenyl synthetase family protein | Regulator |
| F5K02_RS16170 (F5K02_16270) | degQ | 3257008..3257148 (-) | 141 | WP_003152043.1 | degradation enzyme regulation protein DegQ | Regulator |
| F5K02_RS16175 (F5K02_16280) | - | 3257611..3257952 (+) | 342 | WP_007408677.1 | hypothetical protein | - |
| F5K02_RS16180 (F5K02_16285) | - | 3257959..3259182 (-) | 1224 | WP_007408678.1 | EAL and HDOD domain-containing protein | - |
| F5K02_RS16185 (F5K02_16290) | - | 3259312..3260778 (-) | 1467 | WP_014305722.1 | nicotinate phosphoribosyltransferase | - |
| F5K02_RS16190 (F5K02_16295) | - | 3260796..3261347 (-) | 552 | WP_003152033.1 | isochorismatase family cysteine hydrolase | - |
| F5K02_RS16195 (F5K02_16300) | - | 3261444..3261842 (-) | 399 | WP_003152031.1 | DUF1694 domain-containing protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5518.30 Da Isoelectric Point: 4.9432
>NTDB_id=340846 F5K02_RS16170 WP_003152043.1 3257008..3257148(-) (degQ) [Bacillus amyloliquefaciens strain ZKY01]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=340846 F5K02_RS16170 WP_003152043.1 3257008..3257148(-) (degQ) [Bacillus amyloliquefaciens strain ZKY01]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
89.13 |
100 |
0.891 |