Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   ETK71_RS16415 Genome accession   NZ_CP035411
Coordinates   3139585..3139725 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain SRCM103622     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3134585..3144725
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ETK71_RS16390 (ETK71_16390) yuxO 3134928..3135308 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  ETK71_RS16395 (ETK71_16395) comA 3135327..3135971 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  ETK71_RS16400 (ETK71_16400) comP 3136052..3138352 (-) 2301 WP_088300729.1 histidine kinase Regulator
  ETK71_RS16405 (ETK71_16405) comX 3138364..3138528 (-) 165 WP_015384519.1 competence pheromone ComX -
  ETK71_RS16410 (ETK71_16410) - 3138541..3139401 (-) 861 WP_041850585.1 polyprenyl synthetase family protein -
  ETK71_RS16415 (ETK71_16415) degQ 3139585..3139725 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  ETK71_RS22175 - 3139947..3140009 (+) 63 Protein_3154 hypothetical protein -
  ETK71_RS16420 (ETK71_16420) - 3140188..3140556 (+) 369 WP_041850584.1 hypothetical protein -
  ETK71_RS16425 (ETK71_16425) pdeH 3140532..3141761 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  ETK71_RS16430 (ETK71_16430) pncB 3141898..3143370 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  ETK71_RS16435 (ETK71_16435) pncA 3143386..3143937 (-) 552 WP_043940186.1 isochorismatase family cysteine hydrolase -
  ETK71_RS16440 (ETK71_16440) yueI 3144034..3144432 (-) 399 WP_032726794.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=340741 ETK71_RS16415 WP_003220708.1 3139585..3139725(-) (degQ) [Bacillus subtilis strain SRCM103622]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=340741 ETK71_RS16415 WP_003220708.1 3139585..3139725(-) (degQ) [Bacillus subtilis strain SRCM103622]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment